• latinclima.org
  • 0570wx.com
  • 1056thirdavenue.com
  • gisellemoss96.skyrock.com
  • ob.dk
  • albartusiroma.it
  • inkyeditorial.com
  • pamsunconsulting.com
  • grettaportillo0.joomla.com
  • dinnerdiy.com
  • moneyout.net
  • julihuntsman8037.7x.cz
  • canada-qoose.com
  • califestyleproperty.com
  • 125bj.com
  • fxcopycloud.com
  • elgharbya.com
  • janellerothschild.myblog.de
  • bakuguideservice.com
  • cristianhwkzo.qowap.com
  • leonardolahey90.wordpress.com
  • sch-fc.com
  • nadiaflynn.com
  • 456qpyx4011.com
  • 3weeekdietplan.com
  • strategyandcontent.com
  • ruhsmap.org
  • gokhantaspinar.net
  • mumkinsale.com
  • cafeplaynewport.com
  • imperialexcavatingllc.com
  • kaza-namaz.com
  • michaelasierra9.webgarden.at
  • newcastlecountypropertyforsale.com
  • cracupuncture.com
  • ritatheodore863.soup.io
  • effectiveforesight.info
  • 100yearsofbadfood.info
  • brainmindmemory.com
  • fantasyebook.info
  • actrocket.com
  • jilliantunn2.pen.io
  • svoydom.net.ua
  • garrisonartsupply.com
  • consultoresyasesoresjuridicos.com
  • charlotteorthopedic.com
  • 2102nvictoriadr.com
  • jenifermoulden94.wikidot.com
  • 411console.com
  • stroehlein.de
  • 3dmgame.info
  • aux-rives-du-cher.com
  • connectchakra.com
  • farnboroughphysio.com
  • 10athletes.com
  • aesystechs.com
  • elsiestreit04646.wikidot.com
  • wearemonths.com
  • leonardbeaudry.soup.io
  • beatriceleonard.com
  • linktargeter.com
  • baldwinrewards.com
  • kellys3dmascara.com
  • 113arthuravenue.com
  • edgardoalfaro8605.wordpress.com
  • yknufolyzeth.mihanblog.com
  • 5a6v.com
  • denovolegals.com
  • reganschiffman145.soup.io
  • store.metmuseum.org
  • 59898985.com
  • darmasol.com
  • govtsearches.com
  • allinsurance.kz
  • airconditioningrepairaaaemergencyservicesneworleans.com
  • mexidelitogo.com
  • noithatotobacninh1.bizwebvietnam.net
  • 1515007.com
  • 2popscreative.com
  • santiagobagot.tumblr.com
  • ipevup.info
  • birstallpharmacy.com
  • bakerenergyteam.org
  • floydsmartt0.webgarden.at
  • 101paws.com
  • testdccrdtsep16.org
  • amorproibodo.com
  • alineappel9613.wordpress.com
  • 3baosoft.net
  • bettinasorensen8.pen.io
  • penelopethebulldog.com
  • 311aa.com
  • joinlibre.org
  • agoralimo.com
  • kiralikotoaraba.com
  • game-offline.info
  • conozcacostarica.com
  • watergrass.biz
  • durodrives.com
  • bernadineurbina59.wikidot.com
  • hraskuv.blog.cz
  • aebchun457038.joomla.com
  • 3wheeelll.com
  • brainandbodyfuel.com
  • jmxsw.com
  • dixiemcdougall.soup.io
  • 24-6homecare.net
  • santeinterimaire.com
  • moneymakersus.com
  • securedes.info
  • puertasdehangar.com
  • 919911.info
  • smila.in.ua
  • noblesher3591925.bcz.com
  • examenespsicometricosonline.com
  • ahmic.edu.bd
  • doctorbeary.com
  • ebpportraits.com
  • 3dprinttechnology.com
  • kellysretreatatlivingstonecove.com
  • gregorycastles.joomla.com
  • 420to.com
  • 555smh.com
  • elpersonalista.com
  • scentedalpacatragedy.tumblr.com
  • flylightwarehouse.net
  • floridalotterywinningnumbers.com
  • 00j00.com
  • 4dim.us
  • vqokassandra.wikidot.com
  • desknwork.com
  • 3dollarvpn.com
  • 17625-74thave.com
  • isabelleneff40.joomla.com
  • kaylenewysocki3.soup.io
  • 3layersecurity.info
  • comehavesomefun.com
  • bacteriophagerx.com
  • blogs.ext.vt.edu
  • couleurafrique.com
  • best-headphone-amp.com
  • 4150deyoavenue.com
  • jessewarner81578.soup.io
  • armandoyancy.edublogs.org
  • lachineraine.com
  • 1gumbosoul.com
  • kush-cow.com
  • greenlaserdepot.com
  • balashiusa.com
  • linkdayton.org
  • microsoftlicensekeys.com
  • hanneloresams2.joomla.com
  • bakeadogabonereview.net
  • babyboutiquetutus.com
  • rent-to-own-twincities.org
  • chastity8319.shop1.cz
  • 00qd.com
  • coloradosbestrealestatebroker.com
  • karlb24745474.myblog.de
  • because-gus.com
  • a7minuteworkout.com
  • dubai-trading.com
  • cannatravels.com
  • hallpaper.com
  • newskic.com
  • gigantis.net
  • 766k.net
  • stevenlongsc.com
  • corruptbytes.com
  • 3dotg.com
  • christenakeegan6.wikidot.com
  • paintlessdentservicesreno.com
  • scheepspraat.nl
  • 10g-sfpp-lrm.com
  • guybogen73.canalblog.com
  • logistics-business-review.com
  • eventsdevoted.com
  • 100gtraining.com
  • smssender.net
  • forexmarketanalysisblog.wordpress.com
  • ktsudbsn.us
  • beauwaldon882213.soup.io
  • 1225pine.com
  • dietassistants.com
  • chasejeffrey.com
  • balancedeffectiveness.com
  • allan78t793862316.wordpress.com
  • ayurvedicmarket.com
  • solar001.com
  • 509772.com
  • nysmarket.com
  • chanaheimbach.tumblr.com
  • daytonfancyfeatherclub.com
  • collegedates.org
  • aaht.info
  • mollydreyer45.skyrock.com
  • 10linemobilya.com
  • 21charm.com
  • 110skyhawk.com
  • bailbondsdowney.net
  • ipicshopping.co.za
  • seogplus.com
  • zafvictor0921.webgarden.at
  • sitererencontre.tk
  • missangiesroom.com
  • kimmberlycapone.com
  • 10161167avsw.com
  • mercedesfoletta.joomla.com
  • 1625glenview213.com
  • ilksouthwharf.com
  • cyrusnaficy.com
  • 911plumbair.com
  • cyndiedwards.net
  • alinak0120402582.7x.cz
  • yaala.biz
  • osagenationcivilrights.com
  • pharmatutor.org
  • romeoshousemovie.com
  • ellacampion61.webgarden.cz
  • flatbedtruckdriverjobsinlouisiana.com
  • home.netcom.com
  • monkeynetwork.net
  • 007686.com
  • joellenbuford80.wikidot.com
  • sugarpimp.biz
  • networkrenew.com
  • athletesinmind.com
  • antoniabourassa59.soup.io
  • 302930.com
  • idn899.com
  • stpatrickcolona.com
  • roomored.com
  • lida43656784545274.pen.io
  • dealvovo.com
  • intervalsc.com
  • csrwork.info
  • 1849vape.com
  • essentialoilsanantonio.com
  • celestecarington.hatenadiary.com
  • miratrap.com
  • esrihkgisportal.com
  • chaussuresuggo.com
  • mrbcorey27255369.webgarden.at
  • 3vm88ir.com
  • 101exchange.com
  • coldbrewbasket.com
  • jockerstube.com
  • crocostars.com
  • b-bwaterdamagenewyork.com
  • bcislandholiday.com
  • 1790media.biz
  • lcgmcs.com
  • 22579windingwoods.com
  • alinaalina.com
  • adrienegooseberr.skyrock.com
  • adaptordietrying.com
  • 6ixo.com
  • abundancewithstephanie.com
  • jschmoe.com
  • roxanabieber0.soup.io
  • wesele.slub-nowysacz.pl
  • dralinavelezortopedia.com
  • morakbq30358.webgarden.at
  • 2brandonpestcontrolwr.com
  • apprisalhud.com
  • how-to-send-imessages-fro36925.blogdigy.com
  • louistownley24.wgz.cz
  • bwavesmartglasses.com
  • babieswitheyebrows.com
  • pacificchord.com
  • crigler-najjar.org
  • 1660barrancairvine.com
  • christihamilton0.webgarden.at
  • lesagencecoumar.com
  • russellpig.com
  • lasiciliawd.com
  • 0j61.com
  • 24poptions.com
  • getcosmetic.com
  • ghodifenujul.mihanblog.com
  • goddesswriting.com
  • filonrouge.info
  • valprerauer56841.soup.io
  • noshoesmedia.info
  • 1-800-pumpkin.com
  • staffevents.net
  • sneakersjordanshl.blog.fc2.com
  • dismarpcsas.com.co
  • yes-games.net
  • nextonlus.it
  • cienciatube.com
  • fiberlasheswithtina.com
  • loamamagement.com
  • ais.usvisa-info.com
  • sibyldicks679139.hatenadiary.com
  • fairtradeaffiliate.org
  • darwindrennen88.joomla.com
  • 1205linderhill.com
  • usresearchwriters.com
  • 0000833.com
  • 360quad.biz
  • seslisensizim.com
  • steviedacomb854.joomla.com
  • 3gperu.com
  • 50milesfresh.com
  • 3fourmedia.com
  • sponsormyarticles.com
  • marvin57b4675.webgarden.at
  • 4changos.com
  • ohiomarijuanaproducts.com
  • ericfawkner7354627.wikidot.com
  • microsoftsoftwareonline.com
  • oracleappssql.net
  • rezyckochiqa.mihanblog.com
  • captainfreddy.de
  • elsegundo310locksmith.com
  • danielastelzer.myblog.de
  • sammyneedles.com
  • baileybrothersinternational.com
  • sherriebrifman375.myblog.de
  • arifq.com
  • 4nbhomes.com
  • michaelvickeryhomes.com
  • marcchidley913.soup.io
  • restlessbookobsession.com
  • koyane.com
  • salvadorc75286.shop1.cz
  • tuong.me
  • 22x0.com
  • 3406erie.com
  • bonitaludwig64.joomla.com
  • 512durwood.info
  • professorwater.com
  • 2texasrealty.info
  • carminefuller.livejournal.com
  • 1183sagegrouse.com
  • ferrytocuba.org
  • deandredespeissis.host-sc.com
  • 3dcrystaltributes.com
  • plexusinskagit.com
  • 0705colagen.com
  • ceobillionaires.com
  • newlifecorning.org
  • richardtuttle.com
  • neuestahl.com
  • 356events.com
  • heinehlers.com
  • cliff91y00032.edublogs.org
  • booyahbody.com
  • 4dvapor.com
  • baby-scans.com
  • gadgetjunkie.org
  • 336xpj.com
  • 91749.info
  • rothplace.com
  • ejuicingforhealth.com
  • 8zone.us
  • weaponway9.webgarden.cz
  • drjiacupuncture.com
  • beautifultweets.co.uk
  • enfoca.com.pe
  • 940viadifelicita.com
  • 1933northmountainave.com
  • opsdeals.com
  • davidsankar.com
  • kobieta.onet.pl
  • myheera.com
  • 3stepbiz.biz
  • baaweepgrahnaweepninnybong.com
  • 300zxturbo.com
  • rahkaneva.com
  • campusjeunes.net
  • apdcares.net
  • rewdesign.co.uk
  • scooterpartsco.com
  • 123netzone.com
  • 9994585.com
  • acustones.com
  • actualidadmediagroup.com
  • bobbystowingrecovery.com
  • haroonismail.com
  • 0x906.com
  • myclonz.info
  • coproscope.com
  • hackit.com.pl
  • sellybee.info
  • wiki.scu.edu
  • scdcr.com
  • smartlappenkoor-alphen.nl
  • ludovirus.com
  • stm-electronics.com
  • sweetnatures.com
  • wohngeld-rechner.com
  • premier.aramex.com
  • 1stclasscolo.net
  • martins-bikeshop.at
  • annihilationfull.com
  • sochi-prokat.info
  • cctalk.com
  • 3333333y.com
  • perma-laboratories.com
  • bestcheapdslr.com
  • 100percentright.com
  • unitedsafeway.com
  • forexntrade.info
  • blablayum.com
  • sindacatocsd.it
  • mytripfund.com
  • ayonmedia.com
  • 3aji9399aaa.com
  • brittenytognazzini.com
  • background-direct.com
  • bailey-bow.com
  • 3pointenvironmental.net
  • connecttomyhome.info
  • evacon.lt
  • lasvegastattooartistjesse.com
  • nflse.com
  • odbone.com
  • futurereadystore.com
  • neurochirurgiaboari.it
  • esports-bergwinkel.de
  • birlikmt2.com
  • hack-store.com
  • hdsonbolum.com
  • bahtours.com
  • rwblife.com
  • arcadeland.net
  • sezonspors.com
  • collinykwht.tinyblogging.com
  • 11xsxs.com
  • azfarmgrown.org
  • australianmaid.com
  • myacessflorida.com
  • mydesignerbathroom.info
  • 567782.info
  • leilajohnson.info
  • 20speed37.com
  • backgroundchecklaw.org
  • sovannaphum168.com
  • henrylawiowa.com
  • worldrugby.org
  • compous.com
  • mjshirts.com
  • panamengineers.com
  • pophaircuts.com
  • 3dprintdeveloper.com
  • lonewolftrait.com
  • buythrivepatches.com
  • fabozzime.com
  • 101studiopress.com
  • dabspropertysales.com
  • sulemajikomu.com
  • aboveandbeyondluxury.com
  • dragonballzvsdokkans.wordpress.com
  • ebn.com.tw
  • ja-e.co.kr
  • daniela-conrad.de
  • gymaffliction.com
  • externz.info
  • domain.9om.com
  • datawarehouseconcepts.org
  • 7scdebtsolutions.com
  • mcad.edu
  • 50seniors.com
  • c92b.com
  • cormob.com
  • 21215camelia.com
  • 0213i.info
  • sunshine-flower.de
  • mytechie.us
  • saint-malo.onvasortir.com
  • asdfjl.com
  • 1011daresbury.info
  • livingisbelieving.com
  • g-forcesystems.net
  • oriental-desire48259.bloginwi.com
  • nectarfurnishedapartmentssanfrancisco.info
  • nihang.org
  • 100kbrave.net
  • zombieco.com
  • cthebuilder.com
  • raqsonline.com
  • 3dtekne.com
  • connexicon.com
  • jwira.com
  • 2zsb.com
  • italservicebordi.abanet.it
  • prescriptionpainreliefcream.com
  • fiwiplace.biz
  • 054288.com
  • 4ierlabs.com
  • belikwit.com
  • deathbyhibachi.com
  • hyundaiofkeeneautovalues.com
  • office365google.com
  • scottbsaunders.org
  • cortonafrance.com
  • stlinflatables.com
  • youfa520.com
  • sanantoniofirewood.net
  • 4310firesidecourt.info
  • songpure.com
  • azhoas.com
  • dandblegalservices.com
  • gambierhotspot.com
  • beckermnstorage.com
  • empaquetandoando.com
  • stellargatewaychakra.com
  • ashkhabatairport.com
  • nbhjmj.com
  • 357lake.com
  • 3days2success.com
  • 2290third.com
  • lakeviewdentalburnaby.com
  • andersonyjpw851740.onesmablog.com
  • monpermisdexploitation.com
  • beachgoat1.blogcindario.com
  • 9291.us
  • roomofwires.com
  • jfcspgh.org
  • stephenkjones.com
  • 00853006.com
  • ensp-adf.com
  • steel-group.blogspot.com
  • mnlgorica.si
  • sale3dpen.com
  • internationalbda.com
  • mipsbank.com
  • 124mapleridgedrive.com
  • acis.uitm.edu.my
  • buyusedinstruments.com
  • minimalviableart.info
  • youprotein.com
  • 392988a.com
  • sydneyfamilyportraits.com
  • kayletable.com
  • 5522145.com
  • monmouth.edu
  • manipal.edu
  • icipresse.iciapps.com
  • nordnetblogi.fi
  • aestheticbluebook.com
  • xgallery.org
  • bevgrollc.org
  • cubacentral.net
  • pharm.reviews
  • 1800maxon.com
  • 382diaperbag.com
  • piercemotel.com
  • allianceforbiz.com
  • promo.web-redactor.com
  • bagswithlove.org
  • modishcatering.com
  • haihong-leather.com
  • expectbs.com
  • 413design.net
  • cinemafantasy.com
  • orleu.kz
  • bahamassparkasmile.com
  • chadbengle.info
  • silversurfers.com
  • thenewidealist.net
  • herbaleliquid.net
  • bvrok.com
  • 1stclassventures.com
  • 11-11angels.com
  • buysghome.com
  • pokersemi.com
  • farhad44.mihanblog.com
  • 258greenleyroad.com
  • forttp.com
  • jmjys.com
  • 100000usjobs.com
  • bcuadvantage.com
  • showupbuildup.org
  • a3financas.com
  • 3uv.org
  • pogonazh.info
  • 0088976.com
  • ibq.com.qa
  • 644qp.com
  • 457planningpro.com
  • ccac.edu
  • azmaginationphotography.com
  • vivathesouth.com
  • njwv.info
  • findalawyerorangecountyca.com
  • 44888999.com
  • 380panthertowntrail.com
  • aandavision.com
  • marketingontherocks.com
  • sayoutha.net
  • kecywowynkif.mihanblog.com
  • academiacoachingformoney.com
  • 686pc.com
  • ru-mah.com
  • daniellawrites.com
  • jazzyladiescafe.com
  • 3dgelclear.com
  • gajendragjawale.com
  • mariage-et-sac-a-dos.com
  • 0gw.org
  • cdirealty.com
  • 1321dilevante.com
  • aghf4.com
  • cannakushfarms.com
  • bailbondsirvinejail.com
  • 501126.com
  • steppsenvironmentalresponse.com
  • 10cpa.com
  • 3dprintondemandservice.com
  • hk100marks.com
  • chevymankato.com
  • adripathi.com
  • 323moonlightdr.com
  • poesiaecia.com
  • 911spill.org
  • 21908.info
  • protocolsaga.com
  • coolairnownv.com
  • vienthongbinhduong.com
  • maxopex.com
  • 0751jz.com
  • whois.webrankstats.com
  • culturalhomesinc.com
  • nukeworkshop.com
  • christian-claus.net
  • deepveggies.com
  • iihd.de
  • detroitpersonalinjurylawyers.net
  • bestdcproperty.com
  • b719.com
  • 3dlips.net
  • 420dealsdenver.info
  • 023zlxh.com
  • bladeincentive.com
  • 1217eighth.com
  • stressballz.com
  • millionplaces.org
  • 4730sabreln.com
  • age.jp
  • 123photobook.com
  • honeybeebymolly.com
  • usedclothing.info
  • 0833yxls.com
  • oyvindvea.com
  • sockxfit.com
  • amehei.com
  • 669ll.com
  • lasourcenice.com
  • 613security.com
  • knothate18.webs.com
  • 1418eastnorthwesthwy.com
  • gurugossiper.com
  • stefanoallievi.it
  • garrisondental.com
  • bobescoffiermaritime.com
  • remaxexecutive.net
  • lloyddegler.com
  • marissaellberger.com
  • adolphus.nl
  • webmediacenter.net
  • koreamagz.com
  • 559644.com
  • 13bets10.net
  • deuteronomy1511ministries.com
  • se-lathos-topo-kai-xrono.tumblr.com
  • 2018missteencolumbia.com
  • ceuta-virtual.com
  • iterization.com
  • dhianayu.com
  • index-me.xyz
  • t4f.org
  • liliastrotter.com
  • patto-mail.com
  • ilhamseptian.net
  • lachineserestaurantphofrederick.com
  • b2tb.org
  • ani-otaku.net
  • ahvino.com
  • hantermann-servietten.info
  • prosites.co.il
  • cummingsgraduateinstitute.com
  • grouchyacademic.com
  • miory.by
  • 0176b.info
  • sanmateocleaningcompany.com
  • latinpolygraph.com
  • cortesworks.org
  • 1110097.com
  • sansas-tau.lt
  • colorwavesinc.com
  • 4brothersrestaurantgroupllc.com
  • 6752littlefallsrd.com
  • 4kelliecourt.com
  • saudadesailing.com
  • gargsanitary.com
  • 411repairs.com
  • chefsofdistinction.com
  • whenimsixtyfour.ca
  • badassclothingco.com
  • tesis.posgrados.udelar.edu.uy
  • 1daysugarfree.com
  • serenitywell.com
  • 080088888.com
  • content.moneyinstructor.com
  • grandpastime.com
  • adamsoos.com
  • rumineat.com
  • stones4homes.co.uk
  • 100daysofasking.com
  • 0iw2.com
  • budvana.net
  • 400cao.com
  • aztecapoorno.com
  • ballancedsolutions.com
  • changethissite.com
  • 0564bb.com
  • pfitenterprise.com
  • 14077canyon.com
  • saloncordeiro.ca
  • 5mservicesgroup.com
  • psrdeal.com
  • thejawpainclinic.net
  • capetownhosting.com
  • aijiuc.com
  • 95516ec.com
  • aidanvideo.com
  • perdeborsasi.net
  • dreamta.org
  • 3rdcoastent.info
  • alliance-luck.com
  • edenfinley.com
  • 4mke.net
  • 1095cform.net
  • scipamendoza.com
  • aafes.com
  • 308skatepark.com
  • 3dolovke.com
  • oasiscafeandmarket.com
  • laurenstraveladventures.com
  • carrollquarries.com
  • halfsteprock.com
  • deantfqc36803.blogdigy.com
  • 2634delmarst.com
  • valleytovalley.us
  • 40cardacademy.com
  • 88136ww.com
  • kandwhite.com
  • vinoriuminternational.com
  • sazeshkhabar.com
  • abrihealth.org
  • sputniksport.com
  • kiteorfly.com
  • dywlkj.com
  • rtlpm.com
  • mashiringthing.com
  • 26108.info
  • 3811100.com
  • drlilygordon.com
  • 4shorelineflooringsupplies.net
  • airgraver.com
  • snowfamily.us
  • alljjang86.info
  • brumadoalevinos.com
  • readonmove.com
  • 3fhomesforsale.net
  • restaurantlemonarque.fr
  • derdpawup.com
  • elmerayala.com
  • addressvisitverification.net
  • nannytemps.com
  • afshankrec.ir
  • 365jdechaussuresa50pourcent.net
  • 420snackshop.org
  • 3rdgradetothecore.com
  • missoulamowers.com
  • adlernmindre.com
  • nazcaflight.com
  • help42.net
  • airboard1.net
  • fmclassicpizza.com
  • etax.skplanet.co.kr
  • 612552.com
  • practicesavingsolutions.com
  • 400sanmiguel.com
  • tattoo-spirit.de
  • healthy-oregon.com
  • pensacolamedicalcenter.com
  • bahaghara.com
  • baliorientaltours.com
  • russellergroup.com
  • ok2pya.cz
  • 101propertymanagement.com
  • portlandawards.com
  • deepumathewphotography.com
  • 4bordenpestcontrol.com
  • djsmaza.info
  • 2019bestminivan.com
  • couchring.com
  • 61stplacetulsa.org
  • aixinclubs.net
  • napier.elim.org.nz
  • mlkelementary.org
  • leilaolfert.com
  • oxygenct.com
  • ppct.caicyt.gov.ar
  • seyahatlife.org
  • ecoshowerturkey.com
  • bottle-sniper.com
  • koydarf.com
  • denisesaavedra.com
  • 1shot1killhotmail.com
  • sherrnc.com
  • piacere-interactive.com
  • fashiontrenders.net
  • mcweinecke.com
  • coinqueens.com
  • 2010ac.com
  • 3tutors.com
  • 041l57j.com
  • 2399sutterparkway.com
  • fbcskate.com
  • bakebread-productions.com
  • delectabella.com
  • 956268.net
  • ispotr.com
  • 1307bb.com
  • droolwear.com
  • sirway.net
  • 180unplugged.com
  • 3dshippingsolutions.com
  • shutdown5.com
  • 4playimpro.com
  • a-medialab.com
  • isitjortsfriday.com
  • phoenixale.com
  • azcollectionperfection.com
  • q8dvd.com
  • collegeprepbasics.com
  • spellensite.nl
  • covernetsol.com
  • skyreachermusic.com
  • metrooperatingsystem.info
  • lamaramuresro.unblog.fr
  • 30a-vacay.org
  • coindumusicien.com
  • andalusian-horse.com
  • konturstudio.hu
  • goflyparaquedismo.com
  • movingguardian.org
  • 56yr.com
  • balcocuk.com
  • commercialconstructionsecurityindenverco.com
  • 22jsb.com
  • omintinsurance.net
  • mcneeliycompanies.com
  • newagenahotel.bi
  • dourdeals.com
  • auto-iasi.ro
  • sandierpastures.com
  • johnnycrgui.tribunablog.com
  • kuenstlerdorf-herrstein.de
  • rm925.com
  • 3powers.org
  • 41-51.com
  • dentrepairaurora.com
  • luatminhkhue.vn
  • 2484prairieavenue.com
  • gowrightgroup.com
  • sajofarm.org
  • psychologyofartists.com
  • baggitude.com
  • echnologies.com
  • astrofotografia.sk
  • 100x100online.com
  • budandvines.com
  • 0707js.com
  • allisondanielsminitries.org
  • azaleavaluation.net
  • b2csmsmarketing.com
  • craneleasingandsales.info
  • 3as1global.com
  • canninja.com
  • 160553.com
  • 364bardeenrd.com
  • 694th.com
  • memory-healer.com
  • clientinstant.info
  • 1188betkr.com
  • donovantaylor.com
  • 360productionmedia.com
  • magnesiumcarbon.at
  • dinukaravimalblog.wordpress.com
  • eldoradohealthco.com
  • babybumpandme.com
  • 21dayshoechallenge.com
  • 3djm.net
  • jago34o.com
  • americanhempassociation.net
  • 350richmondterrace.com
  • 420manda.com
  • 4n-gx.de
  • constathabitabilite.com
  • 2553talmadgeroad.com
  • mv-lengenwang.de
  • 10princessbet.com
  • lumio.com
  • coppin.edu
  • 113pao.com
  • altourpersonalizedservice.com
  • 101sauces.com
  • 5linxoffaith.com
  • 310oakwindway.com
  • austinreferralrealty.com
  • studiocandini.com
  • stceciliacatholic.org
  • 1x0.pw
  • xyxtd.com
  • broasttn.com
  • cfgmerchantsolutions.com
  • pcospaleoprincess.net
  • 3dphoto.us
  • 4soft.de
  • datepolo36.blogdon.net
  • ampacumbres.org
  • yzav9.com
  • magliarugby.com
  • acceleration2017.com
  • sneaksalesnyc.com
  • bethelarchitect.com
  • ihavealotoffriends.com
  • benaturallyou.com
  • aasquared.net
  • kapsel-kaffee.net
  • pediatric-dermatologist.com
  • magdalenadunaband.cz
  • balade-provence.com
  • uceda.edu
  • bisouss.fr
  • 2958ranchgate.com
  • imleiferickson.com
  • spapremium.net
  • ibgp.org
  • successwitheve.com
  • baasgroup.com
  • 1640lajollaranchord.com
  • bagelsonthehudsonhoboken.com
  • wmndvo.com
  • hgas.it
  • resultadosdefutbol.info
  • spkcorner.com
  • startupwire.net
  • iotseries.com
  • 3amazingdays.net
  • dowladanews.com
  • badlandsstagecoach.com
  • 6ip.biz
  • dewannieux.com
  • caribbeannest.com
  • bhflute.com
  • luckylaclede.com
  • boursediamant.com
  • 4posao.com
  • snpvtiti.com
  • 662050.com
  • barbarafuchs.nl
  • amazon-alternatives.org
  • gotbusinesscards.net
  • ripsfitness.com
  • cvcmuster.com
  • 10danceco.com
  • 0255011.com
  • 589grant.com
  • krunkstudios.com
  • metert.com
  • saltyseacorals.com
  • 509332.com
  • lapoolguy.com
  • rgvbud.com
  • decalautomotive.com
  • juliarubicam.com
  • prediksiforex.com
  • 308narragansettct.com
  • daughertymaddox8gainesdalsgaard658.shutterfly.com
  • 1884dartford.com
  • bbouncenrentals.com
  • 3dprintingmegastore.com
  • romtecutilities.com
  • adatickets.com
  • jobsfortechies.com
  • mc.manuscriptcentral.com
  • 52ipay.com
  • 3dmasterpiece.com
  • gf7betterthandeet.com
  • l5.pl
  • vidmo.org
  • shelaoshi.com
  • hec66.com

  • 1   2   3   4   5   6   7   8   9   10   11   12   13   14   15   16   17   18   19   20   21   22   23   24   25   26   27   28   29   30   31   32   33   34   35   36   37   38   39   40   41   42   43   44   45   46   47   48   49   50   51   52   53   54   55   56   57   58   59   60   61   62   63   64   65   66   67   68   69   70   71   72   73   74   75   76   77   78   79   80   81   82   83   84   85   86   87   88   89   90   91   92   93   94   95   96   97   98   99   100   101   102   103   104   105   106   107   108   109   110   111   112   113   114   115   116   117   118   119   120   121   122   123   124   125   126   127   128   129   130   131   132   133   134   135   136   137   138   139   140   141   142   143   144   145   146   147   148   149   150   151   152   153   154   155   156   157   158   159   160   161   162   163   164   165   166   167   168   169   170   171   172   173   174   175   176   177   178   179   180   181   182   183   184   185   186   187   188   189   190   191   192   193   194   195   196   197   198   199   200   201   202   203   204   205   206   207   208   209   210   211   212   213   214   215   216   217   218   219   220   221   222   223   224   225   226   227   228   229   230   231   232   233   234   235   236   237   238   239   240   241   242   243   244   245   246   247   248   249   250   251   252   253   254   255   256   257   258   259   260   261   262   263   264   265   266   267   268   269   270   271   272   273   274   275   276   277   278   279   280   281   282   283   284   285   286   287   288   289   290   291   292   293   294   295   296   297   298   299   300   301   302   303   304   305   306   307   308   309   310   311   312   313   314   315   316   317   318   319   320   321   322   323   324   325   326   327   328   329   330   331   332   333   334   335   336   337   338   339   340   341   342   343   344   345   346   347   348   349   350   351   352   353   354   355   356   357   358   359   360   361   362   363   364   365   366   367   368   369   370   371   372   373   374   375   376   377   378   379   380   381   382   383   384   385   386   387   388   389   390   391   392   393   394   395   396   397   398   399   400   401   402   403   404   405   406   407   408   409   410   411   412   413   414   415   416   417   418   419   420   421   422   423   424   425   426   427   428   429   430   431   432   433   434   435   436   437   438   439   440   441   442   443   444   445   446   447   448   449   450   451   452   453   454   455   456   457   458   459   460   461   462   463   464   465   466   467   468   469   470   471   472   473   474   475   476   477   478   479   480   481   482   483   484   485   486   487   488   489   490   491   492   493   494   495   496   497   498   499   500   501   502   503   504   505   506   507   508   509   510   511   512   513   514   515   516   517   518   519   520   521   522   523   524   525   526   527   528   529   530   531   532   533   534   535   536   537   538   539   540   541   542   543   544   545   546   547   548   549   550   551   552   553   554   555   556   557   558   559   560   561   562   563   564   565   566   567   568   569   570   571   572   573   574   575   576   577   578   579   580   581   582   583   584   585   586   587   588   589   590   591   592   593   594   595   596   597   598   599   600   601   602   603   604   605   606   607   608   609   610   611   612   613   614   615   616   617   618   619   620   621   622   623   624   625   626   627   628   629   630   631   632   633   634   635   636   637   638   639   640   641   642   643   644   645   646   647   648   649   650   651   652   653   654   655   656   657   658   659   660   661   662   663   664   665   666   667   668   669   670   671   672   673   674   675   676   677   678   679   680   681   682   683   684   685   686   687   688   689   690   691   692   693   694   695   696   697   698   699   700   701   702   703   704   705   706   707   708   709   710   711   712   713   714   715   716   717   718   719   720   721   722   723   724   725   726   727   728   729   730   731   732   733   734   735   736   737   738   739   740   741   742   743   744   745   746   747   748   749   750   751   752   753   754   755   756   757   758   759   760   761   762   763   764   765   766   767   768   769   770   771   772   773   774   775   776   777   778   779   780   781   782   783   784   785   786   787   788   789   790   791   792   793   794   795   796   797   798   799   800   801   802   803   804   805   806   807   808   809   810   811   812   813   814   815   816   817   818   819   820   821   822   823   824   825   826   827   828   829   830   831   832   833   834   835   836   837   838   839   840   841   842   843   844   845   846   847   848   849   850   851   852   853   854   855   856   857   858   859   860   861   862   863   864   865   866   867   868   869   870   871   872   873   874   875   876   877   878   879   880   881   882   883   884   885   886   887   888   889   890   891   892   893   894   895   896   897   898   899   900   901   902   903   904   905   906   907   908   909   910   911   912   913   914   915   916   917   918   919   920   921   922   923   924   925   926   927   928   929   930   931   932   933   934   935   936   937   938   939   940   941   942   943   944   945   946   947   948   949   950   951   952   953   954   955   956   957   958   959   960   961   962   963   964   965   966   967   968   969   970   971   972   973   974   975   976   977   978   979   980   981   982   983   984   985   986   987   988   989   990   991   992   993   994   995   996   997   998   999   1000   1001   1002   1003   1004   1005   1006   1007   1008   1009   1010   1011   1012   1013   1014   1015   1016   1017   1018   1019   1020   1021   1022   1023   1024   1025   1026   1027   1028   1029   1030   1031   1032   1033   1034   1035   1036   1037   1038   1039   1040   1041   1042   1043   1044   1045   1046   1047   1048   1049   1050   1051   1052   1053   1054   1055   1056   1057   1058   1059   1060   1061   1062   1063   1064   1065   1066   1067   1068   1069   1070   1071   1072   1073   1074   1075   1076   1077   1078   1079   1080   1081   1082   1083   1084   1085   1086   1087   1088   1089   1090   1091   1092   1093   1094   1095   1096   1097   1098   1099   1100   1101   1102   1103   1104   1105   1106   1107   1108   1109   1110   1111   1112   1113   1114   1115   1116   1117   1118   1119   1120   1121   1122   1123   1124   1125   1126   1127   1128   1129   1130   1131   1132   1133   1134   1135   1136   1137   1138   1139   1140   1141   1142   1143   1144   1145   1146   1147   1148   1149   1150   1151   1152   1153   1154   1155   1156   1157   1158   1159   1160   1161   1162   1163   1164   1165   1166   1167   1168   1169   1170   1171   1172   1173   1174   1175   1176   1177   1178   1179   1180   1181   1182   1183   1184   1185   1186   1187   1188   1189   1190   1191   1192   1193   1194   1195   1196   1197   1198   1199   1200   1201   1202   1203   1204   1205   1206   1207   1208   1209   1210   1211   1212   1213   1214   1215   1216   1217   1218   1219   1220   1221   1222   1223   1224   1225   1226   1227   1228   1229   1230   1231   1232   1233   1234   1235   1236   1237   1238   1239   1240   1241   1242   1243   1244   1245   1246   1247   1248   1249   1250   1251   1252   1253   1254   1255   1256   1257   1258   1259   1260   1261   1262   1263   1264   1265   1266   1267   1268   1269   1270   1271   1272   1273   1274   1275   1276   1277   1278   1279   1280   1281   1282   1283   1284   1285   1286   1287   1288   1289   1290   1291   1292   1293   1294   1295   1296   1297   1298   1299   1300   1301   1302   1303   1304   1305   1306   1307   1308   1309   1310   1311   1312   1313   1314   1315   1316   1317   1318   1319   1320   1321   1322   1323   1324   1325   1326   1327   1328   1329   1330   1331   1332   1333   1334   1335   1336   1337   1338   1339   1340   1341   1342   1343   1344   1345   1346   1347   1348   1349   1350   1351   1352   1353   1354   1355   1356   1357   1358   1359   1360   1361   1362   1363   1364   1365   1366   1367   1368   1369   1370   1371   1372   1373   1374   1375   1376   1377   1378   1379   1380   1381   1382   1383   1384   1385   1386   1387   1388   1389   1390   1391   1392   1393   1394   1395   1396   1397   1398   1399   1400   1401   1402   1403   1404   1405   1406   1407   1408   1409   1410   1411   1412   1413   1414   1415   1416   1417   1418   1419   1420   1421   1422   1423   1424   1425   1426   1427   1428   1429   1430   1431   1432   1433   1434   1435   1436   1437   1438   1439   1440   1441   1442   1443   1444   1445   1446   1447   1448   1449   1450   1451   1452   1453   1454   1455   1456   1457   1458   1459   1460   1461   1462   1463   1464   1465   1466   1467   1468   1469   1470   1471   1472   1473   1474   1475   1476   1477   1478   1479   1480   1481   1482   1483   1484   1485   1486   1487   1488   1489   1490   1491   1492   1493   1494   1495   1496   1497   1498   1499   1500   1501   1502   1503   1504   1505   1506   1507   1508   1509   1510   1511   1512   1513   1514   1515   1516   1517   1518   1519   1520   1521   1522   1523   1524   1525   1526   1527   1528   1529   1530   1531   1532   1533   1534   1535   1536   1537   1538   1539   1540   1541   1542   1543   1544   1545   1546   1547   1548   1549   1550   1551   1552   1553   1554   1555   1556   1557   1558   1559   1560   1561   1562   1563   1564   1565   1566   1567   1568   1569   1570   1571   1572   1573   1574   1575   1576   1577   1578   1579   1580   1581   1582   1583   1584   1585   1586   1587   1588   1589   1590   1591   1592   1593   1594   1595   1596   1597   1598   1599   1600   1601   1602   1603   1604   1605   1606   1607   1608   1609   1610   1611   1612   1613   1614   1615   1616   1617   1618   1619   1620   1621   1622   1623   1624   1625   1626   1627   1628   1629   1630   1631   1632   1633   1634   1635   1636   1637   1638   1639   1640   1641   1642   1643   1644   1645   1646   1647   1648   1649   1650   1651   1652   1653   1654   1655   1656   1657   1658   1659   1660   1661   1662   1663   1664   1665   1666   1667   1668   1669   1670   1671   1672   1673   1674   1675   1676   1677   1678   1679   1680   1681   1682   1683   1684   1685   1686   1687   1688   1689   1690   1691   1692   1693   1694   1695   1696   1697   1698   1699   1700   1701   1702   1703   1704   1705   1706   1707   1708   1709   1710   1711   1712   1713   1714   1715   1716   1717   1718   1719   1720   1721   1722   1723   1724   1725   1726   1727   1728   1729   1730   1731   1732   1733   1734   1735   1736   1737   1738   1739   1740   1741   1742   1743   1744   1745   1746   1747   1748   1749   1750   1751   1752   1753   1754   1755   1756   1757   1758   1759   1760   1761   1762   1763   1764   1765   1766   1767   1768   1769   1770   1771   1772   1773   1774   1775   1776   1777   1778   1779   1780   1781   1782   1783   1784   1785   1786   1787   1788   1789   1790   1791   1792   1793   1794   1795   1796   1797   1798   1799   1800   1801   1802   1803   1804   1805   1806   1807   1808   1809   1810   1811   1812   1813   1814   1815   1816   1817   1818   1819   1820   1821   1822   1823   1824   1825   1826   1827   1828   1829   1830   1831   1832   1833   1834   1835   1836   1837   1838   1839   1840   1841   1842   1843   1844   1845   1846   1847   1848   1849   1850   1851   1852   1853   1854   1855   1856   1857   1858   1859   1860   1861   1862   1863   1864   1865   1866   1867   1868   1869   1870   1871   1872   1873   1874   1875   1876   1877   1878   1879   1880   1881   1882   1883   1884   1885   1886   1887   1888   1889   1890   1891   1892   1893   1894   1895   1896   1897   1898   1899   1900   1901   1902   1903   1904   1905   1906   1907   1908   1909   1910   1911   1912   1913   1914   1915   1916   1917   1918   1919   1920   1921   1922   1923   1924   1925   1926   1927   1928   1929   1930   1931   1932   1933   1934   1935   1936   1937   1938   1939   1940   1941   1942   1943   1944   1945   1946   1947   1948   1949   1950   1951   1952   1953   1954   1955   1956   1957   1958   1959   1960   1961   1962   1963   1964   1965   1966   1967   1968   1969   1970   1971   1972   1973   1974   1975   1976   1977   1978   1979   1980   1981   1982   1983   1984   1985   1986   1987   1988   1989   1990   1991   1992   1993   1994   1995   1996   1997   1998   1999   2000   2001   2002   2003   2004   2005   2006   2007   2008   2009   2010   2011   2012   2013   2014   2015   2016   2017   2018   2019   2020   2021   2022   2023   2024   2025   2026   2027   2028   2029   2030   2031   2032   2033   2034   2035   2036   2037   2038   2039   2040   2041   2042   2043   2044   2045   2046   2047   2048   2049   2050   2051   2052   2053   2054   2055   2056   2057   2058   2059   2060   2061   2062   2063   2064   2065   2066   2067   2068   2069   2070   2071   2072   2073   2074   2075   2076   2077   2078   2079   2080   2081   2082   2083   2084   2085   2086   2087   2088   2089   2090   2091   2092   2093   2094   2095   2096   2097   2098   2099   2100   2101   2102   2103   2104   2105   2106   2107   2108   2109   2110   2111   2112   2113   2114   2115   2116   2117   2118   2119   2120   2121   2122   2123   2124   2125   2126   2127   2128   2129   2130   2131   2132   2133   2134   2135   2136   2137   2138   2139   2140   2141   2142   2143   2144   2145   2146   2147   2148   2149   2150   2151   2152   2153   2154   2155   2156   2157   2158   2159   2160   2161   2162   2163   2164   2165   2166   2167   2168   2169   2170   2171   2172   2173   2174   2175   2176   2177   2178   2179   2180   2181   2182   2183   2184   2185   2186   2187   2188   2189   2190   2191   2192   2193   2194   2195   2196   2197   2198   2199   2200   2201   2202   2203   2204   2205   2206   2207   2208   2209   2210   2211   2212   2213   2214   2215   2216   2217   2218   2219   2220   2221   2222   2223   2224   2225   2226   2227   2228   2229   2230   2231   2232   2233   2234   2235   2236   2237   2238   2239   2240   2241   2242   2243   2244   2245   2246   2247   2248   2249   2250   2251   2252   2253   2254   2255   2256   2257   2258   2259   2260   2261   2262   2263   2264   2265   2266   2267   2268   2269   2270   2271   2272   2273   2274   2275   2276   2277   2278   2279   2280   2281   2282   2283   2284   2285   2286   2287   2288   2289   2290   2291   2292   2293   2294   2295   2296   2297   2298   2299   2300   2301   2302   2303   2304   2305   2306   2307   2308   2309   2310   2311   2312   2313   2314   2315   2316   2317   2318   2319   2320   2321   2322   2323   2324   2325   2326   2327   2328   2329   2330   2331   2332   2333   2334   2335   2336   2337   2338   2339   2340   2341   2342   2343   2344   2345   2346   2347   2348   2349   2350   2351   2352   2353   2354   2355   2356   2357   2358   2359   2360   2361   2362   2363   2364   2365   2366   2367   2368   2369   2370   2371   2372   2373   2374   2375   2376   2377   2378   2379   2380   2381   2382   2383   2384   2385   2386   2387   2388   2389   2390   2391   2392   2393   2394   2395   2396   2397   2398   2399   2400   2401   2402   2403   2404   2405   2406   2407   2408   2409   2410   2411   2412   2413   2414   2415   2416   2417   2418   2419   2420   2421   2422   2423   2424   2425   2426   2427   2428   2429   2430   2431   2432   2433   2434   2435   2436   2437   2438   2439   2440   2441   2442   2443   2444   2445   2446   2447   2448   2449   2450   2451   2452   2453   2454   2455   2456   2457   2458   2459   2460   2461   2462   2463   2464   2465   2466   2467   2468   2469   2470   2471   2472   2473   2474   2475   2476   2477   2478   2479   2480   2481   2482   2483   2484   2485   2486   2487   2488   2489   2490   2491   2492   2493   2494   2495   2496   2497   2498   2499   2500   2501   2502   2503   2504   2505   2506   2507   2508   2509   2510   2511   2512   2513   2514   2515   2516   2517   2518   2519   2520   2521   2522   2523   2524   2525   2526   2527   2528   2529   2530   2531   2532   2533   2534   2535   2536   2537   2538   2539   2540   2541   2542   2543   2544   2545   2546   2547   2548   2549   2550   2551   2552   2553   2554   2555   2556   2557   2558   2559   2560   2561   2562   2563   2564   2565   2566   2567   2568   2569   2570   2571   2572   2573   2574   2575   2576   2577   2578   2579   2580   2581   2582   2583   2584   2585   2586   2587   2588   2589   2590   2591   2592   2593   2594   2595   2596   2597   2598   2599   2600   2601   2602   2603   2604   2605   2606   2607   2608   2609   2610   2611   2612   2613   2614   2615   2616   2617   2618   2619   2620   2621   2622   2623   2624   2625   2626   2627   2628   2629   2630   2631   2632   2633   2634   2635   2636   2637   2638   2639   2640   2641   2642   2643   2644   2645   2646   2647   2648   2649   2650   2651   2652   2653   2654   2655   2656   2657   2658   2659   2660   2661   2662   2663   2664   2665   2666   2667   2668   2669   2670   2671   2672   2673   2674   2675   2676   2677   2678   2679   2680   2681   2682   2683   2684   2685   2686   2687   2688   2689   2690   2691   2692   2693   2694   2695   2696   2697   2698   2699   2700   2701   2702   2703   2704   2705   2706   2707   2708   2709   2710   2711   2712   2713   2714   2715   2716   2717   2718   2719   2720   2721   2722   2723   2724   2725   2726   2727   2728   2729   2730   2731   2732   2733   2734   2735   2736   2737   2738   2739   2740   2741   2742   2743   2744   2745   2746   2747   2748   2749   2750   2751   2752   2753   2754   2755   2756   2757   2758   2759   2760   2761   2762   2763   2764   2765   2766   2767   2768   2769   2770   2771   2772   2773   2774   2775   2776   2777   2778   2779   2780   2781   2782   2783   2784   2785   2786   2787   2788   2789   2790   2791   2792   2793   2794   2795   2796   2797   2798   2799   2800   2801   2802   2803   2804   2805   2806   2807   2808   2809   2810   2811   2812   2813   2814   2815   2816   2817   2818   2819   2820   2821   2822   2823   2824   2825   2826   2827   2828   2829   2830   2831   2832   2833   2834   2835   2836   2837   2838   2839   2840   2841   2842   2843   2844   2845   2846   2847   2848   2849   2850   2851   2852   2853   2854   2855   2856   2857   2858   2859   2860   2861   2862   2863   2864   2865   2866   2867   2868   2869   2870   2871   2872   2873   2874   2875   2876   2877   2878   2879   2880   2881   2882   2883   2884   2885   2886   2887   2888   2889   2890   2891   2892   2893   2894   2895   2896   2897   2898   2899   2900   2901   2902   2903   2904   2905   2906   2907   2908   2909   2910   2911   2912   2913   2914   2915   2916   2917   2918   2919   2920   2921   2922   2923   2924   2925   2926   2927   2928   2929   2930   2931   2932   2933   2934   2935   2936   2937   2938   2939   2940   2941   2942   2943   2944   2945   2946   2947   2948   2949   2950   2951   2952   2953   2954   2955   2956   2957   2958   2959   2960   2961   2962   2963   2964   2965   2966   2967   2968   2969   2970   2971   2972   2973   2974   2975   2976   2977   2978   2979   2980   2981   2982   2983   2984   2985   2986   2987   2988   2989   2990   2991   2992   2993   2994   2995   2996   2997   2998   2999   3000   3001   3002   3003   3004   3005   3006   3007   3008   3009   3010   3011   3012   3013   3014   3015   3016   3017   3018   3019   3020   3021   3022   3023   3024   3025   3026   3027   3028   3029   3030   3031   3032   3033   3034   3035   3036   3037   3038   3039   3040   3041   3042   3043   3044   3045   3046   3047   3048   3049   3050   3051   3052   3053   3054   3055   3056   3057   3058   3059   3060   3061   3062   3063   3064   3065   3066   3067   3068   3069   3070   3071   3072   3073   3074   3075   3076   3077   3078   3079   3080   3081   3082   3083   3084   3085   3086   3087   3088   3089   3090   3091   3092   3093   3094   3095   3096   3097   3098   3099   3100   3101   3102   3103   3104   3105   3106   3107   3108   3109   3110   3111   3112   3113   3114   3115   3116   3117   3118   3119   3120   3121   3122   3123   3124   3125   3126   3127   3128   3129   3130   3131   3132   3133   3134   3135   3136   3137   3138   3139   3140   3141   3142   3143   3144   3145   3146   3147   3148   3149   3150   3151   3152   3153   3154   3155   3156   3157   3158   3159   3160   3161   3162   3163   3164   3165   3166   3167   3168   3169   3170   3171   3172   3173   3174   3175   3176   3177   3178   3179   3180   3181   3182   3183   3184   3185   3186   3187   3188   3189   3190   3191   3192   3193   3194   3195   3196   3197   3198   3199   3200   3201   3202   3203   3204   3205   3206   3207   3208   3209   3210   3211   3212   3213   3214   3215   3216   3217   3218   3219   3220   3221   3222   3223   3224   3225   3226   3227   3228   3229   3230   3231   3232   3233   3234   3235   3236   3237   3238   3239   3240   3241   3242   3243   3244   3245   3246   3247   3248   3249   3250   3251   3252   3253   3254   3255   3256   3257   3258   3259   3260   3261   3262   3263   3264   3265   3266   3267   3268   3269   3270   3271   3272   3273   3274   3275   3276   3277   3278   3279   3280   3281   3282   3283   3284   3285   3286   3287   3288   3289   3290   3291   3292   3293   3294   3295   3296   3297   3298   3299   3300   3301   3302   3303   3304   3305   3306   3307   3308   3309   3310   3311   3312   3313   3314   3315   3316   3317   3318   3319   3320   3321   3322   3323   3324   3325   3326   3327   3328   3329   3330   3331   3332   3333   3334   3335   3336   3337   3338   3339   3340   3341   3342   3343   3344   3345   3346   3347   3348   3349   3350   3351   3352   3353   3354   3355   3356   3357   3358   3359   3360   3361   3362   3363   3364   3365   3366   3367   3368   3369   3370   3371   3372   3373   3374   3375   3376   3377   3378   3379   3380   3381   3382   3383   3384   3385   3386   3387   3388   3389   3390   3391   3392   3393   3394   3395   3396   3397   3398   3399   3400   3401   3402   3403   3404   3405   3406   3407   3408   3409   3410   3411   3412   3413   3414   3415   3416   3417   3418   3419   3420   3421   3422   3423   3424   3425   3426   3427   3428   3429   3430   3431   3432   3433   3434   3435   3436   3437   3438   3439   3440   3441   3442   3443   3444   3445   3446   3447   3448   3449   3450   3451   3452   3453   3454   3455   3456   3457   3458   3459   3460   3461   3462   3463   3464   3465   3466   3467   3468   3469   3470   3471   3472   3473   3474   3475   3476   3477   3478   3479   3480   3481   3482   3483   3484   3485   3486   3487   3488   3489   3490   3491   3492   3493   3494   3495   3496   3497   3498   3499   3500   3501   3502   3503   3504   3505   3506   3507   3508   3509   3510   3511   3512   3513   3514   3515   3516   3517   3518   3519   3520   3521   3522   3523   3524   3525   3526   3527   3528   3529   3530   3531   3532   3533   3534   3535   3536   3537   3538   3539   3540   3541   3542   3543   3544   3545   3546   3547   3548   3549   3550   3551   3552   3553   3554   3555   3556   3557   3558   3559   3560   3561   3562   3563   3564   3565   3566   3567   3568   3569   3570   3571   3572   3573   3574   3575   3576   3577   3578   3579   3580   3581   3582   3583   3584   3585   3586   3587   3588   3589   3590   3591   3592   3593   3594   3595   3596   3597   3598   3599   3600   3601   3602   3603   3604   3605   3606   3607   3608   3609   3610   3611   3612   3613   3614   3615   3616   3617   3618   3619   3620   3621   3622   3623   3624   3625   3626   3627   3628   3629   3630   3631   3632   3633   3634   3635   3636   3637   3638   3639   3640   3641   3642   3643   3644   3645   3646   3647   3648   3649   3650   3651   3652   3653   3654   3655   3656   3657   3658   3659   3660   3661   3662   3663   3664   3665   3666   3667   3668   3669   3670   3671   3672   3673   3674   3675   3676   3677   3678   3679   3680   3681   3682   3683   3684   3685   3686   3687   3688   3689   3690   3691   3692   3693   3694   3695   3696   3697   3698   3699   3700   3701   3702   3703   3704   3705   3706   3707   3708   3709   3710   3711   3712   3713   3714   3715   3716   3717   3718   3719   3720   3721   3722   3723   3724   3725   3726   3727   3728   3729   3730   3731   3732   3733   3734   3735   3736   3737   3738   3739   3740   3741   3742   3743   3744   3745   3746   3747   3748   3749   3750   3751   3752   3753   3754   3755   3756   3757   3758   3759   3760   3761   3762   3763   3764   3765   3766   3767   3768   3769   3770   3771   3772   3773   3774   3775   3776   3777   3778   3779   3780   3781   3782   3783   3784   3785   3786   3787   3788   3789   3790   3791   3792   3793   3794   3795   3796   3797   3798   3799   3800   3801   3802   3803   3804   3805   3806   3807   3808   3809   3810   3811   3812   3813   3814   3815   3816   3817   3818   3819   3820   3821   3822   3823   3824   3825   3826   3827   3828   3829   3830   3831   3832   3833   3834   3835   3836   3837   3838   3839   3840   3841   3842   3843   3844   3845   3846   3847   3848   3849   3850   3851   3852   3853   3854   3855   3856   3857   3858   3859   3860   3861   3862   3863   3864   3865   3866   3867   3868   3869   3870   3871   3872   3873   3874   3875   3876   3877   3878   3879   3880   3881   3882   3883   3884   3885   3886   3887   3888   3889   3890   3891   3892   3893   3894   3895   3896   3897   3898   3899   3900   3901   3902   3903   3904   3905   3906   3907   3908   3909   3910   3911   3912   3913   3914   3915   3916   3917   3918   3919   3920   3921   3922   3923   3924   3925   3926   3927   3928   3929   3930   3931   3932   3933   3934   3935   3936   3937   3938   3939   3940   3941   3942   3943   3944   3945   3946   3947   3948   3949   3950   3951   3952   3953   3954   3955   3956   3957   3958   3959   3960   3961   3962   3963   3964   3965   3966   3967   3968   3969   3970   3971   3972   3973   3974   3975   3976   3977   3978   3979   3980   3981   3982   3983   3984   3985   3986   3987   3988   3989   3990   3991   3992   3993   3994   3995   3996   3997   3998   3999   4000   4001   4002   4003   4004   4005   4006   4007   4008   4009   4010   4011   4012   4013   4014   4015   4016   4017   4018   4019   4020   4021   4022   4023   4024   4025   4026   4027   4028   4029   4030   4031   4032   4033   4034   4035   4036   4037   4038   4039   4040   4041   4042   4043   4044   4045   4046   4047   4048   4049   4050   4051   4052   4053   4054   4055   4056   4057   4058   4059   4060   4061   4062   4063   4064   4065   4066   4067   4068   4069   4070   4071   4072   4073   4074   4075   4076   4077   4078   4079   4080   4081   4082   4083   4084   4085   4086   4087   4088   4089   4090   4091   4092   4093   4094   4095   4096   4097   4098   4099   4100   4101   4102   4103   4104   4105   4106   4107   4108   4109   4110   4111   4112   4113   4114   4115   4116   4117   4118   4119   4120   4121   4122   4123   4124   4125   4126   4127   4128   4129   4130   4131   4132   4133   4134   4135   4136   4137   4138   4139   4140   4141   4142   4143   4144   4145   4146   4147   4148   4149   4150   4151   4152   4153   4154   4155   4156   4157   4158   4159   4160   4161   4162   4163   4164   4165   4166   4167   4168   4169   4170   4171   4172   4173   4174   4175   4176   4177   4178   4179   4180   4181   4182   4183   4184   4185   4186   4187   4188   4189   4190   4191   4192   4193   4194   4195   4196   4197   4198   4199   4200   4201   4202   4203   4204   4205   4206   4207   4208   4209   4210   4211   4212   4213   4214   4215   4216   4217   4218   4219   4220   4221   4222   4223   4224   4225   4226   4227   4228   4229   4230   4231   4232   4233   4234   4235   4236   4237   4238   4239   4240   4241   4242   4243   4244   4245   4246   4247   4248   4249   4250   4251   4252   4253   4254   4255   4256   4257   4258   4259   4260   4261   4262   4263   4264   4265   4266   4267   4268   4269   4270   4271   4272   4273   4274   4275   4276   4277   4278   4279   4280   4281   4282   4283   4284   4285   4286   4287   4288   4289   4290   4291   4292   4293   4294   4295   4296   4297   4298   4299   4300   4301   4302   4303   4304   4305   4306   4307   4308   4309   4310   4311   4312   4313   4314   4315   4316   4317   4318   4319   4320   4321   4322   4323   4324   4325   4326   4327   4328   4329   4330   4331   4332   4333   4334   4335   4336   4337   4338   4339   4340   4341   4342   4343   4344   4345   4346   4347   4348   4349   4350   4351   4352   4353   4354   4355   4356   4357   4358   4359   4360   4361   4362   4363   4364   4365   4366   4367   4368   4369   4370   4371   4372   4373   4374   4375   4376   4377   4378   4379   4380   4381   4382   4383   4384   4385   4386   4387   4388   4389   4390   4391   4392   4393   4394   4395   4396   4397   4398   4399   4400   4401   4402   4403   4404   4405   4406   4407   4408   4409   4410   4411   4412   4413   4414   4415   4416   4417   4418   4419   4420   4421   4422   4423   4424   4425   4426   4427   4428   4429   4430   4431   4432   4433   4434   4435   4436   4437   4438   4439   4440   4441   4442   4443   4444   4445   4446   4447   4448   4449   4450   4451   4452   4453   4454   4455   4456   4457   4458   4459   4460   4461   4462   4463   4464   4465   4466   4467   4468   4469   4470   4471   4472   4473   4474   4475   4476   4477   4478   4479   4480   4481   4482   4483   4484   4485   4486   4487   4488   4489   4490   4491   4492   4493   4494   4495   4496   4497   4498   4499   4500   4501   4502   4503   4504   4505   4506   4507   4508   4509   4510   4511   4512   4513   4514   4515   4516   4517   4518   4519   4520   4521   4522   4523   4524   4525   4526   4527   4528   4529   4530   4531   4532   4533   4534   4535   4536   4537   4538   4539   4540   4541   4542   4543   4544   4545   4546   4547   4548   4549   4550   4551   4552   4553   4554   4555   4556   4557   4558   4559   4560   4561   4562   4563   4564   4565   4566   4567   4568   4569   4570   4571   4572   4573   4574   4575   4576   4577   4578   4579   4580   4581   4582   4583   4584   4585   4586   4587   4588   4589   4590   4591   4592   4593   4594   4595   4596   4597   4598   4599   4600   4601   4602   4603   4604   4605   4606   4607   4608   4609   4610   4611   4612   4613   4614   4615   4616   4617   4618   4619   4620   4621   4622   4623   4624   4625   4626   4627   4628   4629   4630   4631   4632   4633   4634   4635   4636   4637   4638   4639   4640   4641   4642   4643   4644   4645   4646   4647   4648   4649   4650   4651   4652   4653   4654   4655   4656   4657   4658   4659   4660   4661   4662   4663   4664   4665   4666   4667   4668   4669   4670   4671   4672   4673   4674   4675   4676   4677   4678   4679   4680   4681   4682   4683   4684   4685   4686   4687   4688   4689   4690   4691   4692   4693   4694   4695   4696   4697   4698   4699   4700   4701   4702   4703   4704   4705   4706   4707   4708   4709   4710   4711   4712   4713   4714   4715   4716   4717   4718   4719   4720   4721   4722   4723   4724   4725   4726   4727   4728   4729   4730   4731   4732   4733   4734   4735   4736   4737   4738   4739   4740   4741   4742   4743   4744   4745   4746   4747   4748   4749   4750   4751   4752   4753   4754   4755   4756   4757   4758   4759   4760   4761   4762   4763   4764   4765   4766   4767   4768   4769   4770   4771   4772   4773   4774   4775   4776   4777   4778   4779   4780   4781   4782   4783   4784   4785   4786   4787   4788   4789   4790   4791   4792   4793   4794   4795   4796   4797   4798   4799   4800   4801   4802   4803   4804   4805   4806   4807   4808   4809   4810   4811   4812   4813   4814   4815   4816   4817   4818   4819   4820   4821   4822   4823   4824   4825   4826   4827   4828   4829   4830   4831   4832   4833   4834   4835   4836   4837   4838   4839   4840   4841   4842   4843   4844   4845   4846   4847   4848   4849   4850   4851   4852   4853   4854   4855   4856   4857   4858   4859   4860   4861   4862   4863   4864   4865   4866   4867   4868   4869   4870   4871   4872   4873   4874   4875   4876   4877   4878   4879   4880   4881   4882   4883   4884   4885   4886   4887   4888   4889   4890   4891   4892   4893   4894   4895   4896   4897   4898   4899   4900   4901   4902   4903   4904   4905   4906   4907   4908   4909   4910   4911   4912   4913   4914   4915   4916   4917   4918   4919   4920   4921   4922   4923   4924   4925   4926   4927   4928   4929   4930   4931   4932   4933   4934   4935   4936   4937   4938   4939   4940   4941   4942   4943   4944   4945   4946   4947   4948   4949   4950   4951   4952   4953   4954   4955   4956   4957   4958   4959   4960   4961   4962   4963   4964   4965   4966   4967   4968   4969   4970   4971   4972   4973   4974   4975   4976   4977   4978   4979   4980   4981   4982   4983   4984   4985   4986   4987   4988   4989   4990   4991   4992   4993   4994   4995   4996   4997   4998   4999   5000   5001   5002   5003   5004   5005   5006   5007   5008   5009   5010   5011   5012   5013   5014   5015   5016   5017   5018   5019   5020   5021   5022   5023   5024   5025   5026   5027   5028   5029   5030   5031   5032   5033   5034   5035   5036   5037   5038   5039   5040   5041   5042   5043   5044   5045   5046   5047   5048   5049   5050   5051   5052   5053   5054   5055   5056   5057   5058   5059   5060   5061   5062   5063   5064   5065   5066   5067   5068   5069   5070   5071   5072   5073   5074   5075   5076   5077   5078   5079   5080   5081   5082   5083   5084   5085   5086   5087   5088   5089   5090   5091   5092   5093   5094   5095   5096   5097   5098   5099   5100   5101   5102   5103   5104   5105   5106   5107   5108   5109   5110   5111   5112   5113   5114   5115   5116   5117   5118   5119   5120   5121   5122   5123   5124   5125   5126   5127   5128   5129   5130   5131   5132   5133   5134   5135   5136   5137   5138   5139   5140   5141   5142   5143   5144   5145   5146   5147   5148   5149   5150   5151   5152   5153   5154   5155   5156   5157   5158   5159   5160   5161   5162   5163   5164   5165   5166   5167   5168   5169   5170   5171   5172   5173   5174   5175   5176   5177   5178   5179   5180   5181   5182   5183   5184   5185   5186   5187   5188   5189   5190   5191   5192   5193   5194   5195   5196   5197   5198   5199   5200   5201   5202   5203   5204   5205   5206   5207   5208   5209   5210   5211   5212   5213   5214   5215   5216   5217   5218   5219   5220   5221   5222   5223   5224   5225   5226   5227   5228   5229   5230   5231   5232   5233   5234   5235   5236   5237   5238   5239   5240   5241   5242   5243   5244   5245   5246   5247   5248   5249   5250   5251   5252   5253   5254   5255   5256   5257   5258   5259   5260   5261   5262   5263   5264   5265   5266   5267   5268   5269   5270   5271   5272   5273   5274   5275   5276   5277   5278   5279   5280   5281   5282   5283   5284   5285   5286   5287   5288   5289   5290   5291   5292   5293   5294   5295   5296   5297   5298   5299   5300   5301   5302   5303   5304   5305   5306   5307   5308   5309   5310   5311   5312   5313   5314   5315   5316   5317   5318   5319   5320   5321   5322   5323   5324   5325   5326   5327   5328   5329   5330   5331   5332   5333   5334   5335   5336   5337   5338   5339   5340   5341   5342   5343   5344   5345   5346   5347   5348   5349   5350   5351   5352   5353   5354   5355   5356   5357   5358   5359   5360   5361   5362   5363   5364   5365   5366   5367   5368   5369   5370   5371   5372   5373   5374   5375   5376   5377   5378   5379   5380   5381   5382   5383   5384   5385   5386   5387   5388   5389   5390   5391   5392   5393   5394   5395   5396   5397   5398   5399   5400   5401   5402   5403   5404   5405   5406   5407   5408   5409   5410   5411   5412   5413   5414   5415   5416   5417   5418   5419   5420   5421   5422   5423   5424   5425   5426   5427   5428   5429   5430   5431   5432   5433   5434   5435   5436   5437   5438   5439   5440   5441   5442   5443   5444   5445   5446   5447   5448   5449   5450   5451   5452   5453   5454   5455   5456   5457   5458   5459   5460   5461   5462   5463   5464   5465   5466   5467   5468   5469   5470   5471   5472   5473   5474   5475   5476   5477   5478   5479   5480   5481   5482   5483   5484   5485   5486   5487   5488   5489   5490   5491   5492   5493   5494   5495   5496   5497   5498   5499   5500   5501   5502   5503   5504   5505   5506   5507   5508   5509   5510   5511   5512   5513   5514   5515   5516   5517   5518   5519   5520   5521   5522   5523   5524   5525   5526   5527   5528   5529   5530   5531   5532   5533   5534   5535   5536   5537   5538   5539   5540   5541   5542   5543   5544   5545   5546   5547   5548   5549   5550   5551   5552   5553   5554   5555   5556   5557   5558   5559   5560   5561   5562   5563   5564   5565   5566   5567   5568   5569   5570   5571   5572   5573   5574   5575   5576   5577   5578   5579   5580   5581   5582   5583   5584   5585   5586   5587   5588   5589   5590   5591   5592   5593   5594   5595   5596   5597   5598   5599   5600   5601   5602   5603   5604   5605   5606   5607   5608   5609   5610   5611   5612   5613   5614   5615   5616   5617   5618   5619   5620   5621   5622   5623   5624   5625   5626   5627   5628   5629   5630   5631   5632   5633   5634   5635   5636   5637   5638   5639   5640   5641   5642   5643   5644   5645   5646   5647   5648   5649   5650   5651   5652   5653   5654   5655   5656   5657   5658   5659   5660   5661   5662   5663   5664   5665   5666   5667   5668   5669   5670   5671   5672   5673   5674   5675   5676   5677   5678   5679   5680   5681   5682   5683   5684   5685   5686   5687   5688   5689   5690   5691   5692   5693   5694   5695   5696   5697   5698   5699   5700   5701   5702   5703   5704   5705   5706   5707   5708   5709   5710   5711   5712   5713   5714   5715   5716   5717   5718   5719   5720   5721   5722   5723   5724   5725   5726   5727   5728   5729   5730   5731   5732   5733   5734   5735   5736   5737   5738   5739   5740   5741   5742   5743   5744   5745   5746   5747   5748   5749   5750   5751   5752   5753   5754   5755   5756   5757   5758   5759   5760   5761   5762   5763   5764   5765   5766   5767   5768   5769   5770   5771   5772   5773   5774   5775   5776   5777   5778   5779   5780   5781   5782   5783   5784   5785   5786   5787   5788   5789   5790   5791   5792   5793   5794   5795   5796   5797   5798   5799   5800   5801   5802   5803   5804   5805   5806   5807   5808   5809   5810   5811   5812   5813   5814   5815   5816   5817   5818   5819   5820   5821   5822   5823   5824   5825   5826   5827   5828   5829   5830   5831   5832   5833   5834   5835   5836   5837   5838   5839   5840   5841   5842   5843   5844   5845   5846   5847   5848   5849   5850   5851   5852   5853   5854   5855   5856   5857   5858   5859   5860   5861   5862   5863   5864   5865   5866   5867   5868   5869   5870   5871   5872   5873   5874   5875   5876   5877   5878   5879   5880   5881   5882   5883   5884   5885   5886   5887   5888   5889   5890   5891   5892   5893   5894   5895   5896   5897   5898   5899   5900   5901   5902   5903   5904   5905   5906   5907   5908   5909   5910   5911   5912   5913   5914   5915   5916   5917   5918   5919   5920   5921   5922   5923   5924   5925   5926   5927   5928   5929   5930   5931   5932   5933   5934   5935   5936   5937   5938   5939   5940   5941   5942   5943   5944   5945   5946   5947   5948   5949   5950   5951   5952   5953   5954   5955   5956   5957   5958   5959   5960   5961   5962   5963   5964   5965   5966   5967   5968   5969   5970   5971   5972   5973   5974   5975   5976   5977   5978   5979   5980   5981   5982   5983   5984   5985   5986   5987   5988   5989   5990   5991   5992   5993   5994   5995   5996   5997   5998   5999   6000   6001   6002   6003   6004   6005   6006   6007   6008   6009   6010   6011   6012   6013   6014   6015   6016   6017   6018   6019   6020   6021   6022   6023   6024   6025   6026   6027   6028   6029   6030   6031   6032   6033   6034   6035   6036   6037   6038   6039   6040   6041   6042   6043   6044   6045   6046   6047   6048   6049   6050   6051   6052   6053   6054   6055   6056   6057   6058   6059   6060   6061   6062   6063   6064   6065   6066   6067   6068   6069   6070   6071   6072   6073   6074   6075   6076   6077   6078   6079   6080   6081   6082   6083   6084   6085   6086   6087   6088   6089   6090   6091   6092   6093   6094   6095   6096   6097   6098   6099   6100   6101   6102   6103   6104   6105   6106   6107   6108   6109   6110   6111   6112   6113   6114   6115   6116   6117   6118   6119   6120   6121   6122   6123   6124   6125   6126   6127   6128   6129   6130   6131   6132   6133   6134   6135   6136   6137   6138   6139   6140   6141   6142   6143   6144   6145   6146   6147   6148   6149   6150   6151   6152   6153   6154   6155   6156   6157   6158   6159   6160   6161   6162   6163   6164   6165   6166   6167   6168   6169   6170   6171   6172   6173   6174   6175   6176   6177   6178   6179   6180   6181   6182   6183   6184   6185   6186   6187   6188   6189   6190   6191   6192   6193   6194   6195   6196   6197   6198   6199   6200   6201   6202   6203   6204   6205   6206   6207   6208   6209   6210   6211   6212   6213   6214   6215   6216   6217   6218   6219   6220   6221   6222   6223   6224   6225   6226   6227   6228   6229   6230   6231   6232   6233   6234   6235   6236   6237   6238   6239   6240   6241   6242   6243   6244   6245   6246   6247   6248   6249   6250   6251   6252   6253   6254   6255   6256   6257   6258   6259   6260   6261   6262   6263   6264   6265   6266   6267   6268   6269   6270   6271   6272   6273   6274   6275   6276   6277   6278   6279   6280   6281   6282   6283   6284   6285   6286   6287   6288   6289   6290   6291   6292   6293   6294   6295   6296   6297   6298   6299   6300   6301   6302   6303   6304   6305   6306   6307   6308   6309   6310   6311   6312   6313   6314   6315   6316   6317   6318   6319   6320   6321   6322   6323   6324   6325   6326   6327   6328   6329   6330   6331   6332   6333   6334   6335   6336   6337   6338   6339   6340   6341   6342   6343   6344   6345   6346   6347   6348   6349   6350   6351   6352   6353   6354   6355   6356   6357   6358   6359   6360   6361   6362   6363   6364   6365   6366   6367   6368   6369   6370   6371   6372   6373   6374   6375   6376   6377   6378   6379   6380   6381   6382   6383   6384   6385   6386   6387   6388   6389   6390   6391   6392   6393   6394   6395   6396   6397   6398   6399   6400   6401   6402   6403   6404   6405   6406   6407   6408   6409   6410   6411   6412   6413   6414   6415   6416   6417   6418   6419   6420   6421   6422   6423   6424   6425   6426   6427   6428   6429   6430   6431   6432   6433   6434   6435   6436   6437   6438   6439   6440   6441   6442   6443   6444   6445   6446   6447   6448   6449   6450   6451   6452   6453   6454   6455   6456   6457   6458   6459   6460   6461   6462   6463   6464   6465   6466   6467   6468   6469   6470   6471   6472   6473   6474   6475   6476   6477   6478   6479   6480   6481   6482   6483   6484   6485   6486   6487   6488   6489   6490   6491   6492   6493   6494   6495   6496   6497   6498   6499   6500   6501   6502   6503   6504   6505   6506   6507   6508   6509   6510   6511   6512   6513   6514   6515   6516   6517   6518   6519   6520   6521   6522   6523   6524   6525   6526   6527   6528   6529   6530   6531   6532   6533   6534   6535   6536   6537   6538   6539   6540   6541   6542   6543   6544   6545   6546   6547   6548   6549   6550   6551   6552   6553   6554   6555   6556   6557   6558   6559   6560   6561   6562   6563   6564   6565   6566   6567   6568   6569   6570   6571   6572   6573   6574   6575   6576   6577   6578   6579   6580   6581   6582   6583   6584   6585   6586   6587   6588   6589   6590   6591   6592   6593   6594   6595   6596   6597   6598   6599   6600   6601   6602   6603   6604   6605   6606   6607   6608   6609   6610   6611   6612   6613   6614   6615   6616   6617   6618   6619   6620   6621   6622   6623   6624   6625   6626   6627   6628   6629   6630   6631   6632   6633   6634   6635   6636   6637   6638   6639   6640   6641   6642   6643   6644   6645   6646   6647   6648   6649   6650   6651   6652   6653   6654   6655   6656   6657   6658   6659   6660   6661   6662   6663   6664   6665   6666   6667   6668   6669   6670   6671   6672   6673   6674   6675   6676   6677   6678   6679   6680   6681   6682   6683   6684   6685   6686   6687   6688   6689   6690   6691   6692   6693   6694   6695   6696   6697   6698   6699   6700   6701   6702   6703   6704   6705   6706   6707   6708   6709   6710   6711   6712   6713   6714   6715   6716   6717   6718   6719   6720   6721   6722   6723   6724   6725   6726   6727   6728   6729   6730   6731   6732   6733   6734   6735   6736   6737   6738   6739   6740   6741   6742   6743   6744   6745   6746   6747   6748   6749   6750   6751   6752   6753   6754   6755   6756   6757   6758   6759   6760   6761   6762   6763   6764   6765   6766   6767   6768   6769   6770   6771   6772   6773   6774   6775   6776   6777   6778   6779   6780   6781   6782   6783   6784   6785   6786   6787   6788   6789   6790   6791   6792   6793   6794   6795   6796   6797   6798   6799   6800   6801   6802   6803   6804   6805   6806   6807   6808   6809   6810   6811   6812   6813   6814   6815   6816   6817   6818   6819   6820   6821   6822   6823   6824   6825   6826   6827   6828   6829   6830   6831   6832   6833   6834   6835   6836   6837   6838   6839   6840   6841   6842   6843   6844   6845   6846   6847   6848   6849   6850   6851   6852   6853   6854   6855   6856   6857   6858   6859   6860   6861   6862   6863   6864   6865   6866   6867   6868   6869   6870   6871   6872   6873   6874   6875   6876   6877   6878   6879   6880   6881   6882   6883   6884   6885   6886   6887   6888   6889   6890   6891   6892   6893   6894   6895   6896   6897   6898   6899   6900   6901   6902   6903   6904   6905   6906   6907   6908   6909   6910   6911   6912   6913   6914   6915   6916   6917   6918   6919   6920   6921   6922   6923   6924   6925   6926   6927   6928   6929   6930   6931   6932   6933   6934   6935   6936   6937   6938   6939   6940   6941   6942   6943   6944   6945   6946   6947   6948   6949   6950   6951   6952   6953   6954   6955   6956   6957   6958   6959   6960   6961   6962   6963   6964   6965   6966   6967   6968   6969   6970   6971   6972   6973   6974   6975   6976   6977   6978   6979   6980   6981   6982   6983   6984   6985   6986   6987   6988   6989   6990   6991   6992   6993   6994   6995   6996   6997   6998   6999   7000   7001   7002   7003   7004   7005   7006   7007   7008   7009   7010   7011   7012   7013   7014   7015   7016   7017   7018   7019   7020   7021   7022   7023   7024   7025   7026   7027   7028   7029   7030   7031   7032   7033   7034   7035   7036   7037   7038   7039   7040   7041   7042   7043   7044   7045   7046   7047   7048   7049   7050   7051   7052   7053   7054   7055   7056   7057   7058   7059   7060   7061   7062   7063   7064   7065   7066   7067   7068   7069   7070   7071   7072   7073   7074   7075   7076   7077   7078   7079   7080   7081   7082   7083   7084   7085   7086   7087   7088   7089   7090   7091   7092   7093   7094   7095   7096   7097   7098   7099   7100   7101   7102   7103   7104   7105   7106   7107   7108   7109   7110   7111   7112   7113   7114   7115   7116   7117   7118   7119   7120   7121   7122   7123   7124   7125   7126   7127   7128   7129   7130   7131   7132   7133   7134   7135   7136   7137   7138   7139   7140   7141   7142   7143   7144   7145   7146   7147   7148   7149   7150   7151   7152   7153   7154   7155   7156   7157   7158   7159   7160   7161   7162   7163   7164   7165   7166   7167   7168   7169   7170   7171   7172   7173   7174   7175   7176   7177   7178   7179   7180   7181   7182   7183   7184   7185   7186   7187   7188   7189   7190   7191   7192   7193   7194   7195   7196   7197   7198   7199   7200   7201   7202   7203   7204   7205   7206   7207   7208   7209   7210   7211   7212   7213   7214   7215   7216   7217   7218   7219   7220   7221   7222   7223   7224   7225   7226   7227   7228   7229   7230   7231   7232   7233   7234   7235   7236   7237   7238   7239   7240   7241   7242   7243   7244   7245   7246   7247   7248   7249   7250   7251   7252   7253   7254   7255   7256   7257   7258   7259   7260   7261   7262   7263   7264   7265   7266   7267   7268   7269   7270   7271   7272   7273   7274   7275   7276   7277   7278   7279   7280   7281   7282   7283   7284   7285   7286   7287   7288   7289   7290   7291   7292   7293   7294   7295   7296   7297   7298   7299   7300   7301   7302   7303   7304   7305   7306   7307   7308   7309   7310   7311   7312   7313   7314   7315   7316   7317   7318   7319   7320   7321   7322   7323   7324   7325   7326   7327   7328   7329   7330   7331   7332   7333   7334   7335   7336   7337   7338   7339   7340   7341   7342   7343   7344   7345   7346   7347   7348   7349   7350   7351   7352   7353   7354   7355   7356   7357   7358   7359   7360   7361   7362   7363   7364   7365   7366   7367   7368   7369   7370   7371   7372   7373   7374   7375   7376   7377   7378   7379   7380   7381   7382   7383   7384   7385   7386   7387   7388   7389   7390   7391   7392   7393   7394   7395   7396   7397   7398   7399   7400   7401   7402   7403   7404   7405   7406   7407   7408   7409   7410   7411   7412   7413   7414   7415   7416   7417   7418   7419   7420   7421   7422   7423   7424   7425   7426   7427   7428   7429   7430   7431   7432   7433   7434   7435   7436   7437   7438   7439   7440   7441   7442   7443   7444   7445   7446   7447   7448   7449   7450   7451   7452   7453   7454   7455   7456   7457   7458   7459   7460   7461   7462   7463   7464   7465   7466   7467   7468   7469   7470   7471   7472   7473   7474   7475   7476   7477   7478   7479   7480   7481   7482   7483   7484   7485   7486   7487   7488   7489   7490   7491   7492   7493   7494   7495   7496   7497   7498   7499   7500   7501   7502   7503   7504   7505   7506   7507   7508   7509   7510   7511   7512   7513   7514   7515   7516   7517   7518   7519   7520   7521   7522   7523   7524   7525   7526   7527   7528   7529   7530   7531   7532   7533   7534   7535   7536   7537   7538   7539   7540   7541   7542   7543   7544   7545   7546   7547   7548   7549   7550   7551   7552   7553   7554   7555   7556   7557   7558   7559   7560   7561   7562   7563   7564   7565   7566   7567   7568   7569   7570   7571   7572   7573   7574   7575   7576   7577   7578   7579   7580   7581   7582   7583   7584   7585   7586   7587   7588   7589   7590   7591   7592   7593   7594   7595   7596   7597   7598   7599   7600   7601   7602   7603   7604   7605   7606   7607   7608   7609   7610   7611   7612   7613   7614   7615   7616   7617   7618   7619   7620   7621   7622   7623   7624   7625   7626   7627   7628   7629   7630   7631   7632   7633   7634   7635   7636   7637   7638   7639   7640   7641   7642   7643   7644   7645   7646   7647   7648   7649   7650   7651   7652   7653   7654   7655   7656   7657   7658   7659   7660   7661   7662   7663   7664   7665   7666   7667   7668   7669   7670   7671   7672   7673   7674   7675   7676   7677   7678   7679   7680   7681   7682   7683   7684   7685   7686   7687   7688   7689   7690   7691   7692   7693   7694   7695   7696   7697   7698   7699   7700   7701   7702   7703   7704   7705   7706   7707   7708   7709   7710   7711   7712   7713   7714   7715   7716   7717   7718   7719   7720   7721   7722   7723   7724   7725   7726   7727   7728   7729   7730   7731   7732   7733   7734   7735   7736   7737   7738   7739   7740   7741   7742   7743   7744   7745   7746   7747   7748   7749   7750   7751   7752   7753   7754   7755   7756   7757   7758   7759   7760   7761   7762   7763   7764   7765   7766   7767   7768   7769   7770   7771   7772   7773   7774   7775   7776   7777   7778   7779   7780   7781   7782   7783   7784   7785   7786   7787   7788   7789   7790   7791   7792   7793   7794   7795   7796   7797   7798   7799   7800   7801   7802   7803   7804   7805   7806   7807   7808   7809   7810   7811   7812   7813   7814   7815   7816   7817   7818   7819   7820   7821   7822   7823   7824   7825   7826   7827   7828   7829   7830   7831   7832   7833   7834   7835   7836   7837   7838   7839   7840   7841   7842   7843   7844   7845   7846   7847   7848   7849   7850   7851   7852   7853   7854   7855   7856   7857   7858   7859   7860   7861   7862   7863   7864   7865   7866   7867   7868   7869   7870   7871   7872   7873   7874   7875   7876   7877   7878   7879   7880   7881   7882   7883   7884   7885   7886   7887   7888   7889   7890   7891   7892   7893   7894   7895   7896   7897   7898   7899   7900   7901   7902   7903   7904   7905   7906   7907   7908   7909   7910   7911   7912   7913   7914   7915   7916   7917   7918   7919   7920   7921   7922   7923   7924   7925   7926   7927   7928   7929   7930   7931   7932   7933   7934   7935   7936   7937   7938   7939   7940   7941   7942   7943   7944   7945   7946   7947   7948   7949   7950   7951   7952   7953   7954   7955   7956   7957   7958   7959   7960   7961   7962   7963   7964   7965   7966   7967   7968   7969   7970   7971   7972   7973   7974   7975   7976   7977   7978   7979   7980   7981   7982   7983   7984   7985   7986   7987   7988   7989   7990   7991   7992   7993   7994   7995   7996   7997   7998   7999   8000   8001   8002   8003   8004   8005   8006   8007   8008   8009   8010   8011   8012   8013   8014   8015   8016   8017   8018   8019   8020   8021   8022   8023   8024   8025   8026   8027   8028   8029   8030   8031   8032   8033   8034   8035   8036   8037   8038   8039   8040   8041   8042   8043   8044   8045   8046   8047   8048   8049   8050   8051   8052   8053   8054   8055   8056   8057   8058   8059   8060   8061   8062   8063   8064   8065   8066   8067   8068   8069   8070   8071   8072   8073   8074   8075   8076   8077   8078   8079   8080   8081   8082   8083   8084   8085   8086   8087   8088   8089   8090   8091   8092   8093   8094   8095   8096   8097   8098   8099   8100   8101   8102   8103   8104   8105   8106   8107   8108   8109   8110   8111   8112   8113   8114   8115   8116   8117   8118   8119   8120   8121   8122   8123   8124   8125   8126   8127   8128   8129   8130   8131   8132   8133   8134   8135   8136   8137   8138   8139   8140   8141   8142   8143   8144   8145   8146   8147   8148   8149   8150   8151   8152   8153   8154   8155   8156   8157   8158   8159   8160   8161   8162   8163   8164   8165   8166   8167   8168   8169   8170   8171   8172   8173   8174   8175   8176   8177   8178   8179   8180   8181   8182   8183   8184   8185   8186   8187   8188   8189   8190   8191   8192   8193   8194   8195   8196   8197   8198   8199   8200   8201   8202   8203   8204   8205   8206   8207   8208   8209   8210   8211   8212   8213   8214   8215   8216   8217   8218   8219   8220   8221   8222   8223   8224   8225   8226   8227   8228   8229   8230   8231   8232   8233   8234   8235   8236   8237   8238   8239   8240   8241   8242   8243   8244   8245   8246   8247   8248   8249   8250   8251   8252   8253   8254   8255   8256   8257   8258   8259   8260   8261   8262   8263   8264   8265   8266   8267   8268   8269   8270   8271   8272   8273   8274   8275   8276   8277   8278   8279   8280   8281   8282   8283   8284   8285   8286   8287   8288   8289   8290   8291   8292   8293   8294   8295   8296   8297   8298   8299   8300   8301   8302   8303   8304   8305   8306   8307   8308   8309   8310   8311   8312   8313   8314   8315   8316   8317   8318   8319   8320   8321   8322   8323   8324   8325   8326   8327   8328   8329   8330   8331   8332   8333   8334   8335   8336   8337   8338   8339   8340   8341   8342   8343   8344   8345   8346   8347   8348   8349   8350   8351   8352   8353   8354   8355   8356   8357   8358   8359   8360   8361   8362   8363   8364   8365   8366   8367   8368   8369   8370   8371   8372   8373   8374   8375   8376   8377   8378   8379   8380   8381   8382   8383   8384   8385   8386   8387   8388   8389   8390   8391   8392   8393   8394   8395   8396   8397   8398   8399   8400   8401   8402   8403   8404   8405   8406   8407   8408   8409   8410   8411   8412   8413   8414   8415   8416   8417   8418   8419   8420   8421   8422   8423   8424   8425   8426   8427   8428   8429   8430   8431   8432   8433   8434   8435   8436   8437   8438   8439   8440   8441   8442   8443   8444   8445   8446   8447   8448   8449   8450   8451   8452   8453   8454   8455   8456   8457   8458   8459   8460   8461   8462   8463   8464   8465   8466   8467   8468   8469   8470   8471   8472   8473   8474   8475   8476   8477   8478   8479   8480   8481   8482   8483   8484   8485   8486   8487   8488   8489   8490   8491   8492   8493   8494   8495   8496   8497   8498   8499   8500   8501   8502   8503   8504   8505   8506   8507   8508   8509   8510   8511   8512   8513   8514   8515   8516   8517   8518   8519   8520   8521   8522   8523   8524   8525   8526   8527   8528   8529   8530   8531   8532   8533   8534   8535   8536   8537   8538   8539   8540   8541   8542   8543   8544   8545   8546   8547   8548   8549   8550   8551   8552   8553   8554   8555   8556   8557   8558   8559   8560   8561   8562   8563   8564   8565   8566   8567   8568   8569   8570   8571   8572   8573   8574   8575   8576   8577   8578   8579   8580   8581   8582   8583   8584   8585   8586   8587   8588   8589   8590   8591   8592   8593   8594   8595   8596   8597   8598   8599   8600   8601   8602   8603   8604   8605   8606   8607   8608   8609   8610   8611   8612   8613   8614   8615   8616   8617   8618   8619   8620   8621   8622   8623   8624   8625   8626   8627   8628   8629   8630   8631   8632   8633   8634   8635   8636   8637   8638   8639   8640   8641   8642   8643   8644   8645   8646   8647   8648   8649   8650   8651   8652   8653   8654   8655   8656   8657   8658   8659   8660   8661   8662   8663   8664   8665   8666   8667   8668   8669   8670   8671   8672   8673   8674   8675   8676   8677   8678   8679   8680   8681   8682   8683   8684   8685   8686   8687   8688   8689   8690   8691   8692   8693   8694   8695   8696   8697   8698   8699   8700   8701   8702   8703   8704   8705   8706   8707   8708   8709   8710   8711   8712   8713   8714   8715   8716   8717   8718   8719   8720   8721   8722   8723   8724   8725   8726   8727   8728   8729   8730   8731   8732   8733   8734   8735   8736   8737   8738   8739   8740   8741   8742   8743   8744   8745   8746   8747   8748   8749   8750   8751   8752   8753   8754   8755   8756   8757   8758   8759   8760   8761   8762   8763   8764   8765   8766   8767   8768   8769   8770   8771   8772   8773   8774   8775   8776   8777   8778   8779   8780   8781   8782   8783   8784   8785   8786   8787   8788   8789   8790   8791   8792   8793   8794   8795   8796   8797   8798   8799   8800   8801   8802   8803   8804   8805   8806   8807   8808   8809   8810   8811   8812   8813   8814   8815   8816   8817   8818   8819   8820   8821   8822   8823   8824   8825   8826   8827   8828   8829   8830   8831   8832   8833   8834   8835   8836   8837   8838   8839   8840   8841   8842   8843   8844   8845   8846   8847   8848   8849   8850   8851   8852   8853   8854   8855   8856   8857   8858   8859   8860   8861   8862   8863   8864   8865   8866   8867   8868   8869   8870   8871   8872   8873   8874   8875   8876   8877   8878   8879   8880   8881   8882   8883   8884   8885   8886   8887   8888   8889   8890   8891   8892   8893   8894   8895   8896   8897   8898   8899   8900   8901   8902   8903   8904   8905   8906   8907   8908   8909   8910   8911   8912   8913   8914   8915   8916   8917   8918   8919   8920   8921   8922   8923   8924   8925   8926   8927   8928   8929   8930   8931   8932   8933   8934   8935   8936   8937   8938   8939   8940   8941   8942   8943   8944   8945   8946   8947   8948   8949   8950   8951   8952   8953   8954   8955   8956   8957   8958   8959   8960   8961   8962   8963   8964   8965   8966   8967   8968   8969   8970   8971   8972   8973   8974   8975   8976   8977   8978   8979   8980   8981   8982   8983   8984   8985   8986   8987   8988   8989   8990   8991   8992   8993   8994   8995   8996   8997   8998   8999   9000   9001   9002   9003   9004   9005   9006   9007   9008   9009   9010   9011   9012   9013   9014   9015   9016   9017   9018   9019   9020   9021   9022   9023   9024   9025   9026   9027   9028   9029   9030   9031   9032   9033   9034   9035   9036   9037   9038   9039   9040   9041   9042   9043   9044   9045   9046   9047   9048   9049   9050   9051   9052   9053   9054   9055   9056   9057   9058   9059   9060   9061   9062   9063   9064   9065   9066   9067   9068   9069   9070   9071   9072   9073   9074   9075   9076   9077   9078   9079   9080   9081   9082   9083   9084   9085   9086   9087   9088   9089   9090   9091   9092   9093   9094   9095   9096   9097   9098   9099   9100   9101   9102   9103   9104   9105   9106   9107   9108   9109   9110   9111   9112   9113   9114   9115   9116   9117   9118   9119   9120   9121   9122   9123   9124   9125   9126   9127   9128   9129   9130   9131   9132   9133   9134   9135   9136   9137   9138   9139   9140   9141   9142   9143   9144   9145   9146   9147   9148   9149   9150   9151   9152   9153   9154   9155   9156   9157   9158   9159   9160   9161   9162   9163   9164   9165   9166   9167   9168   9169   9170   9171   9172   9173   9174   9175   9176   9177   9178   9179   9180   9181   9182   9183   9184   9185   9186   9187   9188   9189   9190   9191   9192   9193   9194   9195   9196   9197   9198   9199   9200   9201   9202   9203   9204   9205   9206   9207   9208   9209   9210   9211   9212   9213   9214   9215   9216   9217   9218   9219   9220   9221   9222   9223   9224   9225   9226   9227   9228   9229   9230   9231   9232   9233   9234   9235   9236   9237   9238   9239   9240   9241   9242   9243   9244   9245   9246   9247   9248   9249   9250   9251   9252   9253   9254   9255   9256   9257   9258   9259   9260   9261   9262   9263   9264   9265   9266   9267   9268   9269   9270   9271   9272   9273   9274   9275   9276   9277   9278   9279   9280   9281   9282   9283   9284   9285   9286   9287   9288   9289   9290   9291   9292   9293   9294   9295   9296   9297   9298   9299   9300   9301   9302   9303   9304   9305   9306   9307   9308   9309   9310   9311   9312   9313   9314   9315   9316   9317   9318   9319   9320   9321   9322   9323   9324   9325   9326   9327   9328   9329   9330   9331   9332   9333   9334   9335   9336   9337   9338   9339   9340   9341   9342   9343   9344   9345   9346   9347   9348   9349   9350   9351   9352   9353   9354   9355   9356   9357   9358   9359   9360   9361   9362   9363   9364   9365   9366   9367   9368   9369   9370   9371   9372   9373   9374   9375   9376   9377   9378   9379   9380   9381   9382   9383   9384   9385   9386   9387   9388   9389   9390   9391   9392   9393   9394   9395   9396   9397   9398   9399   9400   9401   9402   9403   9404   9405   9406   9407   9408   9409   9410   9411   9412   9413   9414   9415   9416   9417   9418   9419   9420   9421   9422   9423   9424   9425   9426   9427   9428   9429   9430   9431   9432   9433   9434   9435   9436   9437   9438   9439   9440   9441   9442   9443   9444   9445   9446   9447   9448   9449   9450   9451   9452   9453   9454   9455   9456   9457   9458   9459   9460   9461   9462   9463   9464   9465   9466   9467   9468   9469   9470   9471   9472   9473   9474   9475   9476   9477   9478   9479   9480   9481   9482   9483   9484   9485   9486   9487   9488   9489   9490   9491   9492   9493   9494   9495   9496   9497   9498   9499   9500   9501   9502   9503   9504   9505   9506   9507   9508   9509   9510   9511   9512   9513   9514   9515   9516   9517   9518   9519   9520   9521   9522   9523   9524   9525   9526   9527   9528   9529   9530   9531   9532   9533   9534   9535   9536   9537   9538   9539   9540   9541   9542   9543   9544   9545   9546   9547   9548   9549   9550   9551   9552   9553   9554   9555   9556   9557   9558   9559   9560   9561   9562   9563   9564   9565   9566   9567   9568   9569   9570   9571   9572   9573   9574   9575   9576   9577   9578   9579   9580   9581   9582   9583   9584   9585   9586   9587   9588   9589   9590   9591   9592   9593   9594   9595   9596   9597   9598   9599   9600   9601   9602   9603   9604   9605   9606   9607   9608   9609   9610   9611   9612   9613   9614   9615   9616   9617   9618   9619   9620   9621   9622   9623   9624   9625   9626   9627   9628   9629   9630   9631   9632   9633   9634   9635   9636   9637   9638   9639   9640   9641   9642   9643   9644   9645   9646   9647   9648   9649   9650   9651   9652   9653   9654   9655   9656   9657   9658   9659   9660   9661   9662   9663   9664   9665   9666   9667   9668   9669   9670   9671   9672   9673   9674   9675   9676   9677   9678   9679   9680   9681   9682   9683   9684   9685   9686   9687   9688   9689   9690   9691   9692   9693   9694   9695   9696   9697   9698   9699   9700   9701   9702   9703   9704   9705   9706   9707   9708   9709   9710   9711   9712   9713   9714   9715   9716   9717   9718   9719   9720   9721   9722   9723   9724   9725   9726   9727   9728   9729   9730   9731   9732   9733   9734   9735   9736   9737   9738   9739   9740   9741   9742   9743   9744   9745   9746   9747   9748   9749   9750   9751   9752   9753   9754   9755   9756   9757   9758   9759   9760   9761   9762   9763   9764   9765   9766   9767   9768   9769   9770   9771   9772   9773   9774   9775   9776   9777   9778   9779   9780   9781   9782   9783   9784   9785   9786   9787   9788   9789   9790   9791   9792   9793   9794   9795   9796   9797   9798   9799   9800   9801   9802   9803   9804   9805   9806   9807   9808   9809   9810   9811   9812   9813   9814   9815   9816   9817   9818   9819   9820   9821   9822   9823   9824   9825   9826   9827   9828   9829   9830   9831   9832   9833   9834   9835   9836   9837   9838   9839   9840   9841   9842   9843   9844   9845   9846   9847   9848   9849   9850   9851   9852   9853   9854   9855   9856   9857   9858   9859   9860   9861   9862   9863   9864   9865   9866   9867   9868   9869   9870   9871   9872   9873   9874   9875   9876   9877   9878   9879   9880   9881   9882   9883   9884   9885   9886   9887   9888   9889   9890   9891   9892   9893   9894   9895   9896   9897   9898   9899   9900   9901   9902   9903   9904   9905   9906   9907   9908   9909   9910   9911   9912   9913   9914   9915   9916   9917   9918   9919   9920   9921   9922   9923   9924   9925   9926   9927   9928   9929   9930   9931   9932   9933   9934   9935   9936   9937   9938   9939   9940   9941   9942   9943   9944   9945   9946   9947   9948   9949   9950   9951   9952   9953   9954   9955   9956   9957   9958   9959   9960   9961   9962   9963   9964   9965   9966   9967   9968   9969   9970   9971   9972   9973   9974   9975   9976   9977   9978   9979   9980   9981   9982   9983   9984   9985   9986   9987   9988   9989   9990   9991   9992   9993   9994   9995   9996   9997   9998   9999   10000   10001   10002   10003   10004   10005   10006   10007   10008   10009   10010   10011   10012   10013   10014   10015   10016   10017   10018   10019   10020   10021   10022   10023   10024   10025   10026   10027   10028   10029   10030   10031   10032   10033   10034   10035   10036   10037   10038   10039   10040   10041   10042   10043   10044   10045   10046   10047   10048   10049   10050   10051   10052   10053   10054   10055   10056   10057   10058   10059   10060   10061   10062   10063   10064   10065   10066   10067   10068   10069   10070   10071   10072   10073   10074   10075   10076   10077   10078   10079   10080   10081   10082   10083   10084   10085   10086   10087   10088   10089   10090   10091   10092   10093   10094   10095   10096   10097   10098   10099   10100   10101   10102   10103   10104   10105   10106   10107   10108   10109   10110   10111   10112   10113   10114   10115   10116   10117   10118   10119   10120   10121   10122   10123   10124   10125   10126   10127   10128   10129   10130   10131   10132   10133   10134   10135   10136   10137   10138   10139   10140   10141   10142   10143   10144   10145   10146   10147   10148   10149   10150   10151   10152   10153   10154   10155   10156   10157   10158   10159   10160   10161   10162   10163   10164   10165   10166   10167   10168   10169   10170   10171   10172   10173   10174   10175   10176   10177   10178   10179   10180   10181   10182   10183   10184   10185   10186   10187   10188   10189   10190   10191   10192   10193   10194   10195   10196   10197   10198   10199   10200   10201   10202   10203   10204   10205   10206   10207   10208   10209   10210   10211   10212   10213   10214   10215   10216   10217   10218   10219   10220   10221   10222   10223   10224   10225   10226   10227   10228   10229   10230   10231   10232   10233   10234   10235   10236   10237   10238   10239   10240   10241   10242   10243   10244   10245   10246   10247   10248   10249   10250   10251   10252   10253   10254   10255   10256   10257   10258   10259   10260   10261   10262   10263   10264   10265   10266   10267   10268   10269   10270   10271   10272   10273   10274   10275   10276   10277   10278   10279   10280   10281   10282   10283   10284   10285   10286   10287   10288   10289   10290   10291   10292   10293   10294   10295   10296   10297   10298   10299   10300   10301   10302   10303   10304   10305   10306   10307   10308   10309   10310   10311   10312   10313   10314   10315   10316   10317   10318   10319   10320   10321   10322   10323   10324   10325   10326   10327   10328   10329   10330   10331   10332   10333   10334   10335   10336   10337   10338   10339   10340   10341   10342   10343   10344   10345   10346   10347   10348   10349   10350   10351   10352   10353   10354   10355   10356   10357   10358   10359   10360   10361   10362   10363   10364   10365   10366   10367   10368   10369   10370   10371   10372   10373   10374   10375   10376   10377   10378   10379   10380   10381   10382   10383   10384   10385   10386   10387   10388   10389   10390   10391   10392   10393   10394   10395   10396   10397   10398   10399   10400   10401   10402   10403   10404   10405   10406   10407   10408   10409   10410   10411   10412   10413   10414   10415   10416   10417   10418   10419   10420   10421   10422   10423   10424   10425   10426   10427   10428   10429   10430   10431   10432   10433   10434   10435   10436   10437   10438   10439   10440   10441   10442   10443   10444   10445   10446   10447   10448   10449   10450   10451   10452   10453   10454   10455   10456   10457   10458   10459   10460   10461   10462   10463   10464   10465   10466   10467   10468   10469   10470   10471   10472   10473   10474   10475   10476   10477   10478   10479   10480   10481   10482   10483   10484   10485   10486   10487   10488   10489   10490   10491   10492   10493   10494   10495   10496   10497   10498   10499   10500   10501   10502   10503   10504   10505   10506   10507   10508   10509   10510   10511   10512   10513   10514   10515   10516   10517   10518   10519   10520   10521   10522   10523   10524   10525   10526   10527   10528   10529   10530   10531   10532   10533   10534   10535   10536   10537   10538   10539   10540   10541   10542   10543   10544   10545   10546   10547   10548   10549   10550   10551   10552   10553   10554   10555   10556   10557   10558   10559   10560   10561   10562   10563   10564   10565   10566   10567   10568   10569   10570   10571   10572   10573   10574   10575   10576   10577   10578   10579   10580   10581   10582   10583   10584   10585   10586   10587   10588   10589   10590   10591   10592   10593   10594   10595   10596   10597   10598   10599   10600   10601   10602   10603   10604   10605   10606   10607   10608   10609   10610   10611   10612   10613   10614   10615   10616   10617   10618   10619   10620   10621   10622   10623   10624   10625   10626   10627   10628   10629   10630   10631   10632   10633   10634   10635   10636   10637   10638   10639   10640   10641   10642   10643   10644   10645   10646   10647   10648   10649   10650   10651   10652   10653   10654   10655   10656   10657   10658   10659   10660   10661   10662   10663   10664   10665   10666   10667   10668   10669   10670   10671   10672   10673   10674   10675   10676   10677   10678   10679   10680   10681   10682   10683   10684   10685   10686   10687   10688   10689   10690   10691   10692   10693   10694   10695   10696   10697   10698   10699   10700   10701   10702   10703   10704   10705   10706   10707   10708   10709   10710   10711   10712   10713   10714   10715   10716   10717   10718   10719   10720   10721   10722   10723   10724   10725   10726   10727   10728   10729   10730   10731   10732   10733   10734   10735   10736   10737   10738   10739   10740   10741   10742   10743   10744   10745   10746   10747   10748   10749   10750   10751   10752   10753   10754   10755   10756   10757   10758   10759   10760   10761   10762   10763   10764   10765   10766   10767   10768   10769   10770   10771   10772   10773   10774   10775   10776   10777   10778   10779   10780   10781   10782   10783   10784   10785   10786   10787   10788   10789   10790   10791   10792   10793   10794   10795   10796   10797   10798   10799   10800   10801   10802   10803   10804   10805   10806   10807   10808   10809   10810   10811   10812   10813   10814   10815   10816   10817   10818   10819   10820   10821   10822   10823   10824   10825   10826   10827   10828   10829   10830   10831   10832   10833   10834   10835   10836   10837   10838   10839   10840   10841   10842   10843   10844   10845   10846   10847   10848   10849   10850   10851   10852   10853   10854   10855   10856   10857   10858   10859   10860   10861   10862   10863   10864   10865   10866   10867   10868   10869   10870   10871   10872   10873   10874   10875   10876   10877   10878   10879   10880   10881   10882   10883   10884   10885   10886   10887   10888   10889   10890   10891   10892   10893   10894   10895   10896   10897   10898   10899   10900   10901   10902   10903   10904   10905   10906   10907   10908   10909   10910   10911   10912   10913   10914   10915   10916   10917   10918   10919   10920   10921   10922   10923   10924   10925   10926   10927   10928   10929   10930   10931   10932   10933   10934   10935   10936   10937   10938   10939   10940   10941   10942   10943   10944   10945   10946   10947   10948   10949   10950   10951   10952   10953   10954   10955   10956   10957   10958   10959   10960   10961   10962   10963   10964   10965   10966   10967   10968   10969   10970   10971   10972   10973   10974   10975   10976   10977   10978   10979   10980   10981   10982   10983   10984   10985   10986   10987   10988   10989   10990   10991   10992   10993   10994   10995   10996   10997   10998   10999   11000   11001   11002   11003   11004   11005   11006   11007   11008   11009   11010   11011   11012   11013   11014   11015   11016   11017   11018   11019   11020   11021   11022   11023   11024   11025   11026   11027   11028   11029   11030   11031   11032   11033   11034   11035   11036   11037   11038   11039   11040   11041   11042   11043   11044   11045   11046   11047   11048   11049   11050   11051   11052   11053   11054   11055   11056   11057   11058   11059   11060   11061   11062   11063   11064   11065   11066   11067   11068   11069   11070   11071   11072   11073   11074   11075   11076   11077   11078   11079   11080   11081   11082   11083   11084   11085   11086   11087   11088   11089   11090   11091   11092   11093   11094   11095   11096   11097   11098   11099   11100   11101   11102   11103   11104   11105   11106   11107   11108   11109   11110   11111   11112   11113   11114   11115   11116   11117   11118   11119   11120   11121   11122   11123   11124   11125   11126   11127   11128   11129   11130   11131   11132   11133   11134   11135   11136   11137   11138   11139   11140   11141   11142   11143   11144   11145   11146   11147   11148   11149   11150   11151   11152   11153   11154   11155   11156   11157   11158   11159   11160   11161   11162   11163   11164   11165   11166   11167   11168   11169   11170   11171   11172   11173   11174   11175   11176   11177   11178   11179   11180   11181   11182   11183   11184   11185   11186   11187   11188   11189   11190   11191   11192   11193   11194   11195   11196   11197   11198   11199   11200   11201   11202   11203   11204   11205   11206   11207   11208   11209   11210   11211   11212   11213   11214   11215   11216   11217   11218   11219   11220   11221   11222   11223   11224   11225   11226   11227   11228   11229   11230   11231   11232   11233   11234   11235   11236   11237   11238   11239   11240   11241   11242   11243   11244   11245   11246   11247   11248   11249   11250   11251   11252   11253   11254   11255   11256   11257   11258   11259   11260   11261   11262   11263   11264   11265   11266   11267   11268   11269   11270   11271   11272   11273   11274   11275   11276   11277   11278   11279   11280   11281   11282   11283   11284   11285   11286   11287   11288   11289   11290   11291   11292   11293   11294   11295   11296   11297   11298   11299   11300   11301   11302   11303   11304   11305   11306   11307   11308   11309   11310   11311   11312   11313   11314   11315   11316   11317   11318   11319   11320   11321   11322   11323   11324   11325   11326   11327   11328   11329   11330   11331   11332   11333   11334   11335   11336   11337   11338   11339   11340   11341   11342   11343   11344   11345   11346   11347   11348   11349   11350   11351   11352   11353   11354   11355   11356   11357   11358   11359   11360   11361   11362   11363   11364   11365   11366   11367   11368   11369   11370   11371   11372   11373   11374   11375   11376   11377   11378   11379   11380   11381   11382   11383   11384   11385   11386   11387   11388   11389   11390   11391   11392   11393   11394   11395   11396   11397   11398   11399   11400   11401   11402   11403   11404   11405   11406   11407   11408   11409   11410   11411   11412   11413   11414   11415   11416   11417   11418   11419   11420   11421   11422   11423   11424   11425   11426   11427   11428   11429   11430   11431   11432   11433   11434   11435   11436   11437   11438   11439   11440   11441   11442   11443   11444   11445   11446   11447   11448   11449   11450   11451   11452   11453   11454   11455   11456   11457   11458   11459   11460   11461   11462   11463   11464   11465   11466   11467   11468   11469   11470   11471   11472   11473   11474   11475   11476   11477   11478   11479   11480   11481   11482   11483   11484   11485   11486   11487   11488   11489   11490   11491   11492   11493   11494   11495   11496   11497   11498   11499   11500   11501   11502   11503   11504   11505   11506   11507   11508   11509   11510   11511   11512   11513   11514   11515   11516   11517   11518   11519   11520   11521   11522   11523   11524   11525   11526   11527   11528   11529   11530   11531   11532   11533   11534   11535   11536   11537   11538   11539   11540   11541   11542   11543   11544   11545   11546   11547   11548   11549   11550   11551   11552   11553   11554   11555   11556   11557   11558   11559   11560   11561   11562   11563   11564   11565   11566   11567   11568   11569   11570   11571   11572   11573   11574   11575   11576   11577   11578   11579   11580   11581   11582   11583   11584   11585   11586   11587   11588   11589   11590   11591   11592   11593   11594   11595   11596   11597   11598   11599   11600   11601   11602   11603   11604   11605   11606   11607   11608   11609   11610   11611   11612   11613   11614   11615   11616   11617   11618   11619   11620   11621   11622   11623   11624   11625   11626   11627   11628   11629   11630   11631   11632   11633   11634   11635   11636   11637   11638   11639   11640   11641   11642   11643   11644   11645   11646   11647   11648   11649   11650   11651   11652   11653   11654   11655   11656   11657   11658   11659   11660   11661   11662   11663   11664   11665   11666   11667   11668   11669   11670   11671   11672   11673   11674   11675   11676   11677   11678   11679   11680   11681   11682   11683   11684   11685   11686   11687   11688   11689   11690   11691   11692   11693   11694   11695   11696   11697   11698   11699   11700   11701   11702   11703   11704   11705   11706   11707   11708   11709   11710   11711   11712   11713   11714   11715   11716   11717   11718   11719   11720   11721   11722   11723   11724   11725   11726   11727   11728   11729   11730   11731   11732   11733   11734   11735   11736   11737   11738   11739   11740   11741   11742   11743   11744   11745   11746   11747   11748   11749   11750   11751   11752   11753   11754   11755   11756   11757   11758   11759   11760   11761   11762   11763   11764   11765   11766   11767   11768   11769   11770   11771   11772   11773   11774   11775   11776   11777   11778   11779   11780   11781   11782   11783   11784   11785   11786   11787   11788   11789   11790   11791   11792   11793   11794   11795   11796   11797   11798   11799   11800   11801   11802   11803   11804   11805   11806   11807   11808   11809   11810   11811   11812   11813   11814   11815   11816   11817   11818   11819   11820   11821   11822   11823   11824   11825   11826   11827   11828   11829   11830   11831   11832   11833   11834   11835   11836   11837   11838   11839   11840   11841   11842   11843   11844   11845   11846   11847   11848   11849   11850   11851   11852   11853   11854   11855   11856   11857   11858   11859   11860   11861   11862   11863   11864   11865   11866   11867   11868   11869   11870   11871   11872   11873   11874   11875   11876   11877   11878   11879   11880   11881   11882   11883   11884   11885   11886   11887   11888   11889   11890   11891   11892   11893   11894   11895   11896   11897   11898   11899   11900   11901   11902   11903   11904   11905   11906   11907   11908   11909   11910   11911   11912   11913   11914   11915   11916   11917   11918   11919   11920   11921   11922   11923   11924   11925   11926   11927   11928   11929   11930   11931   11932   11933   11934   11935   11936   11937   11938   11939   11940   11941   11942   11943   11944   11945   11946   11947   11948   11949   11950   11951   11952   11953   11954   11955   11956   11957   11958   11959   11960   11961   11962   11963   11964   11965   11966   11967   11968   11969   11970   11971   11972   11973   11974   11975   11976   11977   11978   11979   11980   11981   11982   11983   11984   11985   11986   11987   11988   11989   11990   11991   11992   11993   11994   11995   11996   11997   11998   11999   12000   12001   12002   12003   12004   12005   12006   12007   12008   12009   12010   12011   12012   12013   12014   12015   12016   12017   12018   12019   12020   12021   12022   12023   12024   12025   12026   12027   12028   12029   12030   12031   12032   12033   12034   12035   12036   12037   12038   12039   12040   12041   12042   12043   12044   12045   12046   12047   12048   12049   12050   12051   12052   12053   12054   12055   12056   12057   12058   12059   12060   12061   12062   12063   12064   12065   12066   12067   12068   12069   12070   12071   12072   12073   12074   12075   12076   12077   12078   12079   12080   12081   12082   12083   12084   12085   12086   12087   12088   12089   12090   12091   12092   12093   12094   12095   12096   12097   12098   12099   12100   12101   12102   12103   12104   12105   12106   12107   12108   12109   12110   12111   12112   12113   12114   12115   12116   12117   12118   12119   12120   12121   12122   12123   12124   12125   12126   12127   12128   12129   12130   12131   12132   12133   12134   12135   12136   12137   12138   12139   12140   12141   12142   12143   12144   12145   12146   12147   12148   12149   12150   12151   12152   12153   12154   12155   12156   12157   12158   12159   12160   12161   12162   12163   12164   12165   12166   12167   12168   12169   12170   12171   12172   12173   12174   12175   12176   12177   12178   12179   12180   12181   12182   12183   12184   12185   12186   12187   12188   12189   12190   12191   12192   12193   12194   12195   12196   12197   12198   12199   12200   12201   12202   12203   12204   12205   12206   12207   12208   12209   12210   12211   12212   12213   12214   12215   12216   12217   12218   12219   12220   12221   12222   12223   12224   12225   12226   12227   12228   12229   12230   12231   12232   12233   12234   12235   12236   12237   12238   12239   12240   12241   12242   12243   12244   12245   12246   12247   12248   12249   12250   12251   12252   12253   12254   12255   12256   12257   12258   12259   12260   12261   12262   12263   12264   12265   12266   12267   12268   12269   12270   12271   12272   12273   12274   12275   12276   12277   12278   12279   12280   12281   12282   12283   12284   12285   12286   12287   12288   12289   12290   12291   12292   12293   12294   12295   12296   12297   12298   12299   12300   12301   12302   12303   12304   12305   12306   12307   12308   12309   12310   12311   12312   12313   12314   12315   12316   12317   12318   12319   12320   12321   12322   12323   12324   12325   12326   12327   12328   12329   12330   12331   12332   12333   12334   12335   12336   12337   12338   12339   12340   12341   12342   12343   12344   12345   12346   12347   12348   12349   12350   12351   12352   12353   12354   12355   12356   12357   12358   12359   12360   12361   12362   12363   12364   12365   12366   12367   12368   12369   12370   12371   12372   12373   12374   12375   12376   12377   12378   12379   12380   12381   12382   12383   12384   12385   12386   12387   12388   12389   12390   12391   12392   12393   12394   12395   12396   12397   12398   12399   12400   12401   12402   12403   12404   12405   12406   12407   12408   12409   12410   12411   12412   12413   12414   12415   12416   12417   12418   12419   12420   12421   12422   12423   12424   12425   12426   12427   12428   12429   12430   12431   12432   12433   12434   12435   12436   12437   12438   12439   12440   12441   12442   12443   12444   12445   12446   12447   12448   12449   12450   12451   12452   12453   12454   12455   12456   12457   12458   12459   12460   12461   12462   12463   12464   12465   12466   12467   12468   12469   12470   12471   12472   12473   12474   12475   12476   12477   12478   12479   12480   12481   12482   12483   12484   12485   12486   12487   12488   12489   12490   12491   12492   12493   12494   12495   12496   12497   12498   12499   12500   12501   12502   12503   12504   12505   12506   12507   12508   12509   12510   12511   12512   12513   12514   12515   12516   12517   12518   12519   12520   12521   12522   12523   12524   12525   12526   12527   12528   12529   12530   12531   12532   12533   12534   12535   12536   12537   12538   12539   12540   12541   12542   12543   12544   12545   12546   12547   12548   12549   12550   12551   12552   12553   12554   12555   12556   12557   12558   12559   12560   12561   12562   12563   12564   12565   12566   12567   12568   12569   12570   12571   12572   12573   12574   12575   12576   12577   12578   12579   12580   12581   12582   12583   12584   12585   12586   12587   12588   12589   12590   12591   12592   12593   12594   12595   12596   12597   12598   12599   12600   12601   12602   12603   12604   12605   12606   12607   12608   12609   12610   12611   12612   12613   12614   12615   12616   12617   12618   12619   12620   12621   12622   12623   12624   12625   12626   12627   12628   12629   12630   12631   12632   12633   12634   12635   12636   12637   12638   12639   12640   12641   12642   12643   12644   12645   12646   12647   12648   12649   12650   12651   12652   12653   12654   12655   12656   12657   12658   12659   12660   12661   12662   12663   12664   12665   12666   12667   12668   12669   12670   12671   12672   12673   12674   12675   12676   12677   12678   12679   12680   12681   12682   12683   12684   12685   12686   12687   12688   12689   12690   12691   12692   12693   12694   12695   12696   12697   12698   12699   12700   12701   12702   12703   12704   12705   12706   12707   12708   12709   12710   12711   12712   12713   12714   12715   12716   12717   12718   12719   12720   12721   12722   12723   12724   12725   12726   12727   12728   12729   12730   12731   12732   12733   12734   12735   12736   12737   12738   12739   12740   12741   12742   12743   12744   12745   12746   12747   12748   12749   12750   12751   12752   12753   12754   12755   12756   12757   12758   12759   12760   12761   12762   12763   12764   12765   12766   12767   12768   12769   12770   12771   12772   12773   12774   12775   12776   12777   12778   12779   12780   12781   12782   12783   12784   12785   12786   12787   12788   12789   12790   12791   12792   12793   12794   12795   12796   12797   12798   12799   12800   12801   12802   12803   12804   12805   12806   12807   12808   12809   12810   12811   12812   12813   12814   12815   12816   12817   12818   12819   12820   12821   12822   12823   12824   12825   12826   12827   12828   12829   12830   12831   12832   12833   12834   12835   12836   12837   12838   12839   12840   12841   12842   12843   12844   12845   12846   12847   12848   12849   12850   12851   12852   12853   12854   12855   12856   12857   12858   12859   12860   12861   12862   12863   12864   12865   12866   12867   12868   12869   12870   12871   12872   12873   12874   12875   12876   12877   12878   12879   12880   12881   12882   12883   12884   12885   12886   12887   12888   12889   12890   12891   12892   12893   12894   12895   12896   12897   12898   12899   12900   12901   12902   12903   12904   12905   12906   12907   12908   12909   12910   12911   12912   12913   12914   12915   12916   12917   12918   12919   12920   12921   12922   12923   12924   12925   12926   12927   12928   12929   12930   12931   12932   12933   12934   12935   12936   12937   12938   12939   12940   12941   12942   12943   12944   12945   12946   12947   12948   12949   12950   12951   12952   12953   12954   12955   12956   12957   12958   12959   12960   12961   12962   12963   12964   12965   12966   12967   12968   12969   12970   12971   12972   12973   12974   12975   12976   12977   12978   12979   12980   12981   12982   12983   12984   12985   12986   12987   12988   12989   12990   12991   12992   12993   12994   12995   12996   12997   12998   12999   13000   13001   13002   13003   13004   13005   13006   13007   13008   13009   13010   13011   13012   13013   13014   13015   13016   13017   13018   13019   13020   13021   13022   13023   13024   13025   13026   13027   13028   13029   13030   13031   13032   13033   13034   13035   13036   13037   13038   13039   13040   13041   13042   13043   13044   13045   13046   13047   13048   13049   13050   13051   13052   13053   13054   13055   13056   13057   13058   13059   13060   13061   13062   13063   13064   13065   13066   13067   13068   13069   13070   13071   13072   13073   13074   13075   13076   13077   13078   13079   13080   13081   13082   13083   13084   13085   13086   13087   13088   13089   13090   13091   13092   13093   13094   13095   13096   13097   13098   13099   13100   13101   13102   13103   13104   13105   13106   13107   13108   13109   13110   13111   13112   13113   13114   13115   13116   13117   13118   13119   13120   13121   13122   13123   13124   13125   13126   13127   13128   13129   13130   13131   13132   13133   13134   13135   13136   13137   13138   13139   13140   13141   13142   13143   13144   13145   13146   13147   13148   13149   13150   13151   13152   13153   13154   13155   13156   13157   13158   13159   13160   13161   13162   13163   13164   13165   13166   13167   13168   13169   13170   13171   13172   13173   13174   13175   13176   13177   13178   13179   13180   13181   13182   13183   13184   13185   13186   13187   13188   13189   13190   13191   13192   13193   13194   13195   13196   13197   13198   13199   13200   13201   13202   13203   13204   13205   13206   13207   13208   13209   13210   13211   13212   13213   13214   13215   13216   13217   13218   13219   13220   13221   13222   13223   13224   13225   13226   13227   13228   13229   13230   13231   13232   13233   13234   13235   13236   13237   13238   13239   13240   13241   13242   13243   13244   13245   13246   13247   13248   13249   13250   13251   13252   13253   13254   13255   13256   13257   13258   13259   13260   13261   13262   13263   13264   13265   13266   13267   13268   13269   13270   13271   13272   13273   13274   13275   13276   13277   13278   13279   13280   13281   13282   13283   13284   13285   13286   13287   13288   13289   13290   13291   13292   13293   13294   13295   13296   13297   13298   13299   13300   13301   13302   13303   13304   13305   13306   13307   13308   13309   13310   13311   13312   13313   13314   13315   13316   13317   13318   13319   13320   13321   13322   13323   13324   13325   13326   13327   13328   13329   13330   13331   13332   13333   13334   13335   13336   13337   13338   13339   13340   13341   13342   13343   13344   13345   13346   13347   13348   13349   13350   13351   13352   13353   13354   13355   13356   13357   13358   13359   13360   13361   13362   13363   13364   13365   13366   13367   13368   13369   13370   13371   13372   13373   13374   13375   13376   13377   13378   13379   13380   13381   13382   13383   13384   13385   13386   13387   13388   13389   13390   13391   13392   13393   13394   13395   13396   13397   13398   13399   13400   13401   13402   13403   13404   13405   13406   13407   13408   13409   13410   13411   13412   13413   13414   13415   13416   13417   13418   13419   13420   13421   13422   13423   13424   13425   13426   13427   13428   13429   13430   13431   13432   13433   13434   13435   13436   13437   13438   13439   13440   13441   13442   13443   13444   13445   13446   13447   13448   13449   13450   13451   13452   13453   13454   13455   13456   13457   13458   13459   13460   13461   13462   13463   13464   13465   13466   13467   13468   13469   13470   13471   13472   13473   13474   13475   13476   13477   13478   13479   13480   13481   13482   13483   13484   13485   13486   13487   13488   13489   13490   13491   13492   13493   13494   13495   13496   13497   13498   13499   13500   13501   13502   13503   13504   13505   13506   13507   13508   13509   13510   13511   13512   13513   13514   13515   13516   13517   13518   13519   13520   13521   13522   13523   13524   13525   13526   13527   13528   13529   13530   13531   13532   13533   13534   13535   13536   13537   13538   13539   13540   13541   13542   13543   13544   13545   13546   13547   13548   13549   13550   13551   13552   13553   13554   13555   13556   13557   13558   13559   13560   13561   13562   13563   13564   13565   13566   13567   13568   13569   13570   13571   13572   13573   13574   13575   13576   13577   13578   13579   13580   13581   13582   13583   13584   13585   13586   13587   13588   13589   13590   13591   13592   13593   13594   13595   13596   13597   13598   13599   13600   13601   13602   13603   13604   13605   13606   13607   13608   13609   13610   13611   13612   13613   13614   13615   13616   13617   13618   13619   13620   13621   13622   13623   13624   13625   13626   13627   13628   13629   13630   13631   13632   13633   13634   13635   13636   13637   13638   13639   13640   13641   13642   13643   13644   13645   13646   13647   13648   13649   13650   13651   13652   13653   13654   13655   13656   13657   13658   13659   13660   13661   13662   13663   13664   13665   13666   13667   13668   13669   13670   13671   13672   13673   13674   13675   13676   13677   13678   13679   13680   13681   13682   13683   13684   13685   13686   13687   13688   13689   13690   13691   13692   13693   13694   13695   13696   13697   13698   13699   13700   13701   13702   13703   13704   13705   13706   13707   13708   13709   13710   13711   13712   13713   13714   13715   13716   13717   13718   13719   13720   13721   13722   13723   13724   13725   13726   13727   13728   13729   13730   13731   13732   13733   13734   13735   13736   13737   13738   13739   13740   13741   13742   13743   13744   13745   13746   13747   13748   13749   13750   13751   13752   13753   13754   13755   13756   13757   13758   13759   13760   13761   13762   13763   13764   13765   13766   13767   13768   13769   13770   13771   13772   13773   13774   13775   13776   13777   13778   13779   13780   13781   13782   13783   13784   13785   13786   13787   13788   13789   13790   13791   13792   13793   13794   13795   13796   13797   13798   13799   13800   13801   13802   13803   13804   13805   13806   13807   13808   13809   13810   13811   13812   13813   13814   13815   13816   13817   13818   13819   13820   13821   13822   13823   13824   13825   13826   13827   13828   13829   13830   13831   13832   13833   13834   13835   13836   13837   13838   13839   13840   13841   13842   13843   13844   13845   13846   13847   13848   13849   13850   13851   13852   13853   13854   13855   13856   13857   13858   13859   13860   13861   13862   13863   13864   13865   13866   13867   13868   13869   13870   13871   13872   13873   13874   13875   13876   13877   13878   13879   13880   13881   13882   13883   13884   13885   13886   13887   13888   13889   13890   13891   13892   13893   13894   13895   13896   13897   13898   13899   13900   13901   13902   13903   13904   13905   13906   13907   13908   13909   13910   13911   13912   13913   13914   13915   13916   13917   13918   13919   13920   13921   13922   13923   13924   13925   13926   13927   13928   13929   13930   13931   13932   13933   13934   13935   13936   13937   13938   13939   13940   13941   13942   13943   13944   13945   13946   13947   13948   13949   13950   13951   13952   13953   13954   13955   13956   13957   13958   13959   13960   13961   13962   13963   13964   13965   13966   13967   13968   13969   13970   13971   13972   13973   13974   13975   13976   13977   13978   13979   13980   13981   13982   13983   13984   13985   13986   13987   13988   13989   13990   13991   13992   13993   13994   13995   13996   13997   13998   13999   14000   14001   14002   14003   14004   14005   14006   14007   14008   14009   14010   14011   14012   14013   14014   14015   14016   14017   14018   14019   14020   14021   14022   14023   14024   14025   14026   14027   14028   14029   14030   14031   14032   14033   14034   14035   14036   14037   14038   14039   14040   14041   14042   14043   14044   14045   14046   14047   14048   14049   14050   14051   14052   14053   14054   14055   14056   14057   14058   14059   14060   14061   14062   14063   14064   14065   14066   14067   14068   14069   14070   14071   14072   14073   14074   14075   14076   14077   14078   14079   14080   14081   14082   14083   14084   14085   14086   14087   14088   14089   14090   14091   14092   14093   14094   14095   14096   14097   14098   14099   14100   14101   14102   14103   14104   14105   14106   14107   14108   14109   14110   14111   14112   14113   14114   14115   14116   14117   14118   14119   14120   14121   14122   14123   14124   14125   14126   14127   14128   14129   14130   14131   14132   14133   14134   14135   14136   14137   14138   14139   14140   14141   14142   14143   14144   14145   14146   14147   14148   14149   14150   14151   14152   14153   14154   14155   14156   14157   14158   14159   14160   14161   14162   14163   14164   14165   14166   14167   14168   14169   14170   14171   14172   14173   14174   14175   14176   14177   14178   14179   14180   14181   14182   14183   14184   14185   14186   14187   14188   14189   14190   14191   14192   14193   14194   14195   14196   14197   14198   14199   14200   14201   14202   14203   14204   14205   14206   14207   14208   14209   14210   14211   14212   14213   14214   14215   14216   14217   14218   14219   14220   14221   14222   14223   14224   14225   14226   14227   14228   14229   14230   14231   14232   14233   14234   14235   14236   14237   14238   14239   14240   14241   14242   14243   14244   14245   14246   14247   14248   14249   14250   14251   14252   14253   14254   14255   14256   14257   14258   14259   14260   14261   14262   14263   14264   14265   14266   14267   14268   14269   14270   14271   14272   14273   14274   14275   14276   14277   14278   14279   14280   14281   14282   14283   14284   14285   14286   14287   14288   14289   14290   14291   14292   14293   14294   14295   14296   14297   14298   14299   14300   14301   14302   14303   14304   14305   14306   14307   14308   14309   14310   14311   14312   14313   14314   14315   14316   14317   14318   14319   14320   14321   14322   14323   14324   14325   14326   14327   14328   14329   14330   14331   14332   14333   14334   14335   14336   14337   14338   14339   14340   14341   14342   14343   14344   14345   14346   14347   14348   14349   14350   14351   14352   14353   14354   14355   14356   14357   14358   14359   14360   14361   14362   14363   14364   14365   14366   14367   14368   14369   14370   14371   14372   14373   14374   14375   14376   14377   14378   14379   14380   14381   14382   14383   14384   14385   14386   14387   14388   14389   14390   14391   14392   14393   14394   14395   14396   14397   14398   14399   14400   14401   14402   14403   14404   14405   14406   14407   14408   14409   14410   14411   14412   14413   14414   14415   14416   14417   14418   14419   14420   14421   14422   14423   14424   14425   14426   14427   14428   14429   14430   14431   14432   14433   14434   14435   14436   14437   14438   14439   14440   14441   14442   14443   14444   14445   14446   14447   14448   14449   14450   14451   14452   14453   14454   14455   14456   14457   14458   14459   14460   14461   14462   14463   14464   14465   14466   14467   14468   14469   14470   14471   14472   14473   14474   14475   14476   14477   14478   14479   14480   14481   14482   14483   14484   14485   14486   14487   14488   14489   14490   14491   14492   14493   14494   14495   14496   14497   14498   14499   14500   14501   14502   14503   14504   14505   14506   14507   14508   14509   14510   14511   14512   14513   14514   14515   14516   14517   14518   14519   14520   14521   14522   14523   14524   14525   14526   14527   14528   14529   14530   14531   14532   14533   14534   14535   14536   14537   14538   14539   14540   14541   14542   14543   14544   14545   14546   14547   14548   14549   14550   14551   14552   14553   14554   14555   14556   14557   14558   14559   14560   14561   14562   14563   14564   14565   14566   14567   14568   14569   14570   14571   14572   14573   14574   14575   14576   14577   14578   14579   14580   14581   14582   14583   14584   14585   14586   14587   14588   14589   14590   14591   14592   14593   14594   14595   14596   14597   14598   14599   14600   14601   14602   14603   14604   14605   14606   14607   14608   14609   14610   14611   14612   14613   14614   14615   14616   14617   14618   14619   14620   14621   14622   14623   14624   14625   14626   14627   14628   14629   14630   14631   14632   14633   14634   14635   14636   14637   14638   14639   14640   14641   14642   14643   14644   14645   14646   14647   14648   14649   14650   14651   14652   14653   14654   14655   14656   14657   14658   14659   14660   14661   14662   14663   14664   14665   14666   14667   14668   14669   14670   14671   14672   14673   14674   14675   14676   14677   14678   14679   14680   14681   14682   14683   14684   14685   14686   14687   14688   14689   14690   14691   14692   14693   14694   14695   14696   14697   14698   14699   14700   14701   14702   14703   14704   14705   14706   14707   14708   14709   14710   14711   14712   14713   14714   14715   14716   14717   14718   14719   14720   14721   14722   14723   14724   14725   14726   14727   14728   14729   14730   14731   14732   14733   14734   14735   14736   14737   14738   14739   14740   14741   14742   14743   14744   14745   14746   14747   14748   14749   14750   14751   14752   14753   14754   14755   14756   14757   14758   14759   14760   14761   14762   14763   14764   14765   14766   14767   14768   14769   14770   14771   14772   14773   14774   14775   14776   14777   14778   14779   14780   14781   14782   14783   14784   14785   14786   14787   14788   14789   14790   14791   14792   14793   14794   14795   14796   14797   14798   14799   14800   14801   14802   14803   14804   14805   14806   14807   14808   14809   14810   14811   14812   14813   14814   14815   14816   14817   14818   14819   14820   14821   14822   14823   14824   14825   14826   14827   14828   14829   14830   14831   14832   14833   14834   14835   14836   14837   14838   14839   14840   14841   14842   14843   14844   14845   14846   14847   14848   14849   14850   14851   14852   14853   14854   14855   14856   14857   14858   14859   14860   14861   14862   14863   14864   14865   14866   14867   14868   14869   14870   14871   14872   14873   14874   14875   14876   14877   14878   14879   14880   14881   14882   14883   14884   14885   14886   14887   14888   14889   14890   14891   14892   14893   14894   14895   14896   14897   14898   14899   14900   14901   14902   14903   14904   14905   14906   14907   14908   14909   14910   14911   14912   14913   14914   14915   14916   14917   14918   14919   14920   14921   14922   14923   14924   14925   14926   14927   14928   14929   14930   14931   14932   14933   14934   14935   14936   14937   14938   14939   14940   14941   14942   14943   14944   14945   14946   14947   14948   14949   14950   14951   14952   14953   14954   14955   14956   14957   14958   14959   14960   14961   14962   14963   14964   14965   14966   14967   14968   14969   14970   14971   14972   14973   14974   14975   14976   14977   14978   14979   14980   14981   14982   14983   14984   14985   14986   14987   14988   14989   14990   14991   14992   14993   14994   14995   14996   14997   14998   14999   15000   15001   15002   15003   15004   15005   15006   15007   15008   15009   15010   15011   15012   15013   15014   15015   15016   15017   15018   15019   15020   15021   15022   15023   15024   15025   15026   15027   15028   15029   15030   15031   15032   15033   15034   15035   15036   15037   15038   15039   15040   15041   15042   15043   15044   15045   15046   15047   15048   15049   15050   15051   15052   15053   15054   15055   15056   15057   15058   15059   15060   15061   15062   15063   15064   15065   15066   15067   15068   15069   15070   15071   15072   15073   15074   15075   15076   15077   15078   15079   15080   15081   15082   15083   15084   15085   15086   15087   15088   15089   15090   15091   15092   15093   15094   15095   15096   15097   15098   15099   15100   15101   15102   15103   15104   15105   15106   15107   15108   15109   15110   15111   15112   15113   15114   15115   15116   15117   15118   15119   15120   15121   15122   15123   15124   15125   15126   15127   15128   15129   15130   15131   15132   15133   15134   15135   15136   15137   15138   15139   15140   15141   15142   15143   15144   15145   15146   15147   15148   15149   15150   15151   15152   15153   15154   15155   15156   15157   15158   15159   15160   15161   15162   15163   15164   15165   15166   15167   15168   15169   15170   15171   15172   15173   15174   15175   15176   15177   15178   15179   15180   15181   15182   15183   15184   15185   15186   15187   15188   15189   15190   15191   15192   15193   15194   15195   15196   15197   15198   15199   15200   15201   15202   15203   15204   15205   15206   15207   15208   15209   15210   15211   15212   15213   15214   15215   15216   15217   15218   15219   15220   15221   15222   15223   15224   15225   15226   15227   15228   15229   15230   15231   15232   15233   15234   15235   15236   15237   15238   15239   15240   15241   15242   15243   15244   15245   15246   15247   15248   15249   15250   15251   15252   15253   15254   15255   15256   15257   15258   15259   15260   15261   15262   15263   15264   15265   15266   15267   15268   15269   15270   15271   15272   15273   15274   15275   15276   15277   15278   15279   15280   15281   15282   15283   15284   15285   15286   15287   15288   15289   15290   15291   15292   15293   15294   15295   15296   15297   15298   15299   15300   15301   15302   15303   15304   15305   15306   15307   15308   15309   15310   15311   15312   15313   15314   15315   15316   15317   15318   15319   15320   15321   15322   15323   15324   15325   15326   15327   15328   15329   15330   15331   15332   15333   15334   15335   15336   15337   15338   15339   15340   15341   15342   15343   15344   15345   15346   15347   15348   15349   15350   15351   15352   15353   15354   15355   15356   15357   15358   15359   15360   15361   15362   15363   15364   15365   15366   15367   15368   15369   15370   15371   15372   15373   15374   15375   15376   15377   15378   15379   15380   15381   15382   15383   15384   15385   15386   15387   15388   15389   15390   15391   15392   15393   15394   15395   15396   15397   15398   15399   15400   15401   15402   15403   15404   15405   15406   15407   15408   15409   15410   15411   15412   15413   15414   15415   15416   15417   15418   15419   15420   15421   15422   15423   15424   15425   15426   15427   15428   15429   15430   15431   15432   15433   15434   15435   15436   15437   15438   15439   15440   15441   15442   15443   15444   15445   15446   15447   15448   15449   15450   15451   15452   15453   15454   15455   15456   15457   15458   15459   15460   15461   15462   15463   15464   15465   15466   15467   15468   15469   15470   15471   15472   15473   15474   15475   15476   15477   15478   15479   15480   15481   15482   15483   15484   15485   15486   15487   15488   15489   15490   15491   15492   15493   15494   15495   15496   15497   15498   15499   15500   15501   15502   15503   15504   15505   15506   15507   15508   15509   15510   15511   15512   15513   15514   15515   15516   15517   15518   15519   15520   15521   15522   15523   15524   15525   15526   15527   15528   15529   15530   15531   15532   15533   15534   15535   15536   15537   15538   15539   15540   15541   15542   15543   15544   15545   15546   15547   15548   15549   15550   15551   15552   15553   15554   15555   15556   15557   15558   15559   15560   15561   15562   15563   15564   15565   15566   15567   15568   15569   15570   15571   15572   15573   15574   15575   15576   15577   15578   15579   15580   15581   15582   15583   15584   15585   15586   15587   15588   15589   15590   15591   15592   15593   15594   15595   15596   15597   15598   15599   15600   15601   15602   15603   15604   15605   15606   15607   15608   15609   15610   15611   15612   15613   15614   15615   15616   15617   15618   15619   15620   15621   15622   15623   15624   15625   15626   15627   15628   15629   15630   15631   15632   15633   15634   15635   15636   15637   15638   15639   15640   15641   15642   15643   15644   15645   15646   15647   15648   15649   15650   15651   15652   15653   15654   15655   15656   15657   15658   15659   15660   15661   15662   15663   15664   15665   15666   15667   15668   15669   15670   15671   15672   15673   15674   15675   15676   15677   15678   15679   15680   15681   15682   15683   15684   15685   15686   15687   15688   15689   15690   15691   15692   15693   15694   15695   15696   15697   15698   15699   15700   15701   15702   15703   15704   15705   15706   15707   15708   15709   15710   15711   15712   15713   15714   15715   15716   15717   15718   15719   15720   15721   15722   15723   15724   15725   15726   15727   15728   15729   15730   15731   15732   15733   15734   15735   15736   15737   15738   15739   15740   15741   15742   15743   15744   15745   15746   15747   15748   15749   15750   15751   15752   15753   15754   15755   15756   15757   15758   15759   15760   15761   15762   15763   15764   15765   15766   15767   15768   15769   15770   15771   15772   15773   15774   15775   15776   15777   15778   15779   15780   15781   15782   15783   15784   15785   15786   15787   15788   15789   15790   15791   15792   15793   15794   15795   15796   15797   15798   15799   15800   15801   15802   15803   15804   15805   15806   15807   15808   15809   15810   15811   15812   15813   15814   15815   15816   15817   15818   15819   15820   15821   15822   15823   15824   15825   15826   15827   15828   15829   15830   15831   15832   15833   15834   15835   15836   15837   15838   15839   15840   15841   15842   15843   15844   15845   15846   15847   15848   15849   15850   15851   15852   15853   15854   15855   15856   15857   15858   15859   15860   15861   15862   15863   15864   15865   15866   15867   15868   15869   15870   15871   15872   15873   15874   15875   15876   15877   15878   15879   15880   15881   15882   15883   15884   15885   15886   15887   15888   15889   15890   15891   15892   15893   15894   15895   15896   15897   15898   15899   15900   15901   15902   15903   15904   15905   15906   15907   15908   15909   15910   15911   15912   15913   15914   15915   15916   15917   15918   15919   15920   15921   15922   15923   15924   15925   15926   15927   15928   15929   15930   15931   15932   15933   15934   15935   15936   15937   15938   15939   15940   15941   15942   15943   15944   15945   15946   15947   15948   15949   15950   15951   15952   15953   15954   15955   15956   15957   15958   15959   15960   15961   15962   15963   15964   15965   15966   15967   15968   15969   15970   15971   15972   15973   15974   15975   15976   15977   15978   15979   15980   15981   15982   15983   15984   15985   15986   15987   15988   15989   15990   15991   15992   15993   15994   15995   15996   15997   15998   15999   16000   16001   16002   16003   16004   16005   16006   16007   16008   16009   16010   16011   16012   16013   16014   16015   16016   16017   16018   16019   16020   16021   16022   16023   16024   16025   16026   16027   16028   16029   16030   16031   16032   16033   16034   16035   16036   16037   16038   16039   16040   16041   16042   16043   16044   16045   16046   16047   16048   16049   16050   16051   16052   16053   16054   16055   16056   16057   16058   16059   16060   16061   16062   16063   16064   16065   16066   16067   16068   16069   16070   16071   16072   16073   16074   16075   16076   16077   16078   16079   16080   16081   16082   16083   16084   16085   16086   16087   16088   16089   16090   16091   16092   16093   16094   16095   16096   16097   16098   16099   16100   16101   16102   16103   16104   16105   16106   16107   16108   16109   16110   16111   16112   16113   16114   16115   16116   16117   16118   16119   16120   16121   16122   16123   16124   16125   16126   16127   16128   16129   16130   16131   16132   16133   16134   16135   16136   16137   16138   16139   16140   16141   16142   16143   16144   16145   16146   16147   16148   16149   16150   16151   16152   16153   16154   16155   16156   16157   16158   16159   16160   16161   16162   16163   16164   16165   16166   16167   16168   16169   16170   16171   16172   16173   16174   16175   16176   16177   16178   16179   16180   16181   16182   16183   16184   16185   16186   16187   16188   16189   16190   16191   16192   16193   16194   16195   16196   16197   16198   16199   16200   16201   16202   16203   16204   16205   16206   16207   16208   16209   16210   16211   16212   16213   16214   16215   16216   16217   16218   16219   16220   16221   16222   16223   16224   16225   16226   16227   16228   16229   16230   16231   16232   16233   16234   16235   16236   16237   16238   16239   16240   16241   16242   16243   16244   16245   16246   16247   16248   16249   16250   16251   16252   16253   16254   16255   16256   16257   16258   16259   16260   16261   16262   16263   16264   16265   16266   16267   16268   16269   16270   16271   16272   16273   16274   16275   16276   16277   16278   16279   16280   16281   16282   16283   16284   16285   16286   16287   16288   16289   16290   16291   16292   16293   16294   16295   16296   16297   16298   16299   16300   16301   16302   16303   16304   16305   16306   16307   16308   16309   16310   16311   16312   16313   16314   16315   16316   16317   16318   16319   16320   16321   16322   16323   16324   16325   16326   16327   16328   16329   16330   16331   16332   16333   16334   16335   16336   16337   16338   16339   16340   16341   16342   16343   16344   16345   16346   16347   16348   16349   16350   16351   16352   16353   16354   16355   16356   16357   16358   16359   16360   16361   16362   16363   16364   16365   16366   16367   16368   16369   16370   16371   16372   16373   16374   16375   16376   16377   16378   16379   16380   16381   16382   16383   16384   16385   16386   16387   16388   16389   16390   16391   16392   16393   16394   16395   16396   16397   16398   16399   16400   16401   16402   16403   16404   16405   16406   16407   16408   16409   16410   16411   16412   16413   16414   16415   16416   16417   16418   16419   16420   16421   16422   16423   16424   16425   16426   16427   16428   16429   16430   16431   16432   16433   16434   16435   16436   16437   16438   16439   16440   16441   16442   16443   16444   16445   16446   16447   16448   16449   16450   16451   16452   16453   16454   16455   16456   16457   16458   16459   16460   16461   16462   16463   16464   16465   16466   16467   16468   16469   16470   16471   16472   16473   16474   16475   16476   16477   16478   16479   16480   16481   16482   16483   16484   16485   16486   16487   16488   16489   16490   16491   16492   16493   16494   16495   16496   16497   16498   16499   16500   16501   16502   16503   16504   16505   16506   16507   16508   16509   16510   16511   16512   16513   16514   16515   16516   16517   16518   16519   16520   16521   16522   16523   16524   16525   16526   16527   16528   16529   16530   16531   16532   16533   16534   16535   16536   16537   16538   16539   16540   16541   16542   16543   16544   16545   16546   16547   16548   16549   16550   16551   16552   16553   16554   16555   16556   16557   16558   16559   16560   16561   16562   16563   16564   16565   16566   16567   16568   16569   16570   16571   16572   16573   16574   16575   16576   16577   16578   16579   16580   16581   16582   16583   16584   16585   16586   16587   16588   16589   16590   16591   16592   16593   16594   16595   16596   16597   16598   16599   16600   16601   16602   16603   16604   16605   16606   16607   16608   16609   16610   16611   16612   16613   16614   16615   16616   16617   16618   16619   16620   16621   16622   16623   16624   16625   16626   16627   16628   16629   16630   16631   16632   16633   16634   16635   16636   16637   16638   16639   16640   16641   16642   16643   16644   16645   16646   16647   16648   16649   16650   16651   16652   16653   16654   16655   16656   16657   16658   16659   16660   16661   16662   16663   16664   16665   16666   16667   16668   16669   16670   16671   16672   16673   16674   16675   16676   16677   16678   16679   16680   16681   16682   16683   16684   16685   16686   16687   16688   16689   16690   16691   16692   16693   16694   16695   16696   16697   16698   16699   16700   16701   16702   16703   16704   16705   16706   16707   16708   16709   16710   16711   16712   16713   16714   16715   16716   16717   16718   16719   16720   16721   16722   16723   16724   16725   16726   16727   16728   16729   16730   16731   16732   16733   16734   16735   16736   16737   16738   16739   16740   16741   16742   16743   16744   16745   16746   16747   16748   16749   16750   16751   16752   16753   16754   16755   16756   16757   16758   16759   16760   16761   16762   16763   16764   16765   16766   16767   16768   16769   16770   16771   16772   16773   16774   16775   16776   16777   16778   16779   16780   16781   16782   16783   16784   16785   16786   16787   16788   16789   16790   16791   16792   16793   16794   16795   16796   16797   16798   16799   16800   16801   16802   16803   16804   16805   16806   16807   16808   16809   16810   16811   16812   16813   16814   16815   16816   16817   16818   16819   16820   16821   16822   16823   16824   16825   16826   16827   16828   16829   16830   16831   16832   16833   16834   16835   16836   16837   16838   16839   16840   16841   16842   16843   16844   16845   16846   16847   16848   16849   16850   16851   16852   16853   16854   16855   16856   16857   16858   16859   16860   16861   16862   16863   16864   16865   16866   16867   16868   16869   16870   16871   16872   16873   16874   16875   16876   16877   16878   16879   16880   16881   16882   16883   16884   16885   16886   16887   16888   16889   16890   16891   16892   16893   16894   16895   16896   16897   16898   16899   16900   16901   16902   16903   16904   16905   16906   16907   16908   16909   16910   16911   16912   16913   16914   16915   16916   16917   16918   16919   16920   16921   16922   16923   16924   16925   16926   16927   16928   16929   16930   16931   16932   16933   16934   16935   16936   16937   16938   16939   16940   16941   16942   16943   16944   16945   16946   16947   16948   16949   16950   16951   16952   16953   16954   16955   16956   16957   16958   16959   16960   16961   16962   16963   16964   16965   16966   16967   16968   16969   16970   16971   16972   16973   16974   16975   16976   16977   16978   16979   16980   16981   16982   16983   16984   16985   16986   16987   16988   16989   16990   16991   16992   16993   16994   16995   16996   16997   16998   16999   17000   17001   17002   17003   17004   17005   17006   17007   17008   17009   17010   17011   17012   17013   17014   17015   17016   17017   17018   17019   17020   17021   17022   17023   17024   17025   17026   17027   17028   17029   17030   17031   17032   17033   17034   17035   17036   17037   17038   17039   17040   17041   17042   17043   17044   17045   17046   17047   17048   17049   17050   17051   17052   17053   17054   17055   17056   17057   17058   17059   17060   17061   17062   17063   17064   17065   17066   17067   17068   17069   17070   17071   17072   17073   17074   17075   17076   17077   17078   17079   17080   17081   17082   17083   17084   17085   17086   17087   17088   17089   17090   17091   17092   17093   17094   17095   17096   17097   17098   17099   17100   17101   17102   17103   17104   17105   17106   17107   17108   17109   17110   17111   17112   17113   17114   17115   17116   17117   17118   17119   17120   17121   17122   17123   17124   17125   17126   17127   17128   17129   17130   17131   17132   17133   17134   17135   17136   17137   17138   17139   17140   17141   17142   17143   17144   17145   17146   17147   17148   17149   17150   17151   17152   17153   17154   17155   17156   17157   17158   17159   17160   17161   17162   17163   17164   17165   17166   17167   17168   17169   17170   17171   17172   17173   17174   17175   17176   17177   17178   17179   17180   17181   17182   17183   17184   17185   17186   17187   17188   17189   17190   17191   17192   17193   17194   17195   17196   17197   17198   17199   17200   17201   17202   17203   17204   17205   17206   17207   17208   17209   17210   17211   17212   17213   17214   17215   17216   17217   17218   17219   17220   17221   17222   17223   17224   17225   17226   17227   17228   17229   17230   17231   17232   17233   17234   17235   17236   17237   17238   17239   17240   17241   17242   17243   17244   17245   17246   17247   17248   17249   17250   17251   17252   17253   17254   17255   17256   17257   17258   17259   17260   17261   17262   17263   17264   17265   17266   17267   17268   17269   17270   17271   17272   17273   17274   17275   17276   17277   17278   17279   17280   17281   17282   17283   17284   17285   17286   17287   17288   17289   17290   17291   17292   17293   17294   17295   17296   17297   17298   17299   17300   17301   17302   17303   17304   17305   17306   17307   17308   17309   17310   17311   17312   17313   17314   17315   17316   17317   17318   17319   17320   17321   17322   17323   17324   17325   17326   17327   17328   17329   17330   17331   17332   17333   17334   17335   17336   17337   17338   17339   17340   17341   17342   17343   17344   17345   17346   17347   17348   17349   17350   17351   17352   17353   17354   17355   17356   17357   17358   17359   17360   17361   17362   17363   17364   17365   17366   17367   17368   17369   17370   17371   17372   17373   17374   17375   17376   17377   17378   17379   17380   17381   17382   17383   17384   17385   17386   17387   17388   17389   17390   17391   17392   17393   17394   17395   17396   17397   17398   17399   17400   17401   17402   17403   17404   17405   17406   17407   17408   17409   17410   17411   17412   17413   17414   17415   17416   17417   17418   17419   17420   17421   17422   17423   17424   17425   17426   17427   17428   17429   17430   17431   17432   17433   17434   17435   17436   17437   17438   17439   17440   17441   17442   17443   17444   17445   17446   17447   17448   17449   17450   17451   17452   17453   17454   17455   17456   17457   17458   17459   17460   17461   17462   17463   17464   17465   17466   17467   17468   17469   17470   17471   17472   17473   17474   17475   17476   17477   17478   17479   17480   17481   17482   17483   17484   17485   17486   17487   17488   17489   17490   17491   17492   17493   17494   17495   17496   17497   17498   17499   17500   17501   17502   17503   17504   17505   17506   17507   17508   17509   17510   17511   17512   17513   17514   17515   17516   17517   17518   17519   17520   17521   17522   17523   17524   17525   17526   17527   17528   17529   17530   17531   17532   17533   17534   17535   17536   17537   17538   17539   17540   17541   17542   17543   17544   17545   17546   17547   17548   17549   17550   17551   17552   17553   17554   17555   17556   17557   17558   17559   17560   17561   17562   17563   17564   17565   17566   17567   17568   17569   17570   17571   17572   17573   17574   17575   17576   17577   17578   17579   17580   17581   17582   17583   17584   17585   17586   17587   17588   17589   17590   17591   17592   17593   17594   17595   17596   17597   17598   17599   17600   17601   17602   17603   17604   17605   17606   17607   17608   17609   17610   17611   17612   17613   17614   17615   17616   17617   17618   17619   17620   17621   17622   17623   17624   17625   17626   17627   17628   17629   17630   17631   17632   17633   17634   17635   17636   17637   17638   17639   17640   17641   17642   17643   17644   17645   17646   17647   17648   17649   17650   17651   17652   17653   17654   17655   17656   17657   17658   17659   17660   17661   17662   17663   17664   17665   17666   17667   17668   17669   17670   17671   17672   17673   17674   17675   17676   17677   17678   17679   17680   17681   17682   17683   17684   17685   17686   17687   17688   17689   17690   17691   17692   17693   17694   17695   17696   17697   17698   17699   17700   17701   17702   17703   17704   17705   17706   17707   17708   17709   17710   17711   17712   17713   17714   17715   17716   17717   17718   17719   17720   17721   17722   17723   17724   17725   17726   17727   17728   17729   17730   17731   17732   17733   17734   17735   17736   17737   17738   17739   17740   17741   17742   17743   17744   17745   17746   17747   17748   17749   17750   17751   17752   17753   17754   17755   17756   17757   17758   17759   17760   17761   17762   17763   17764   17765   17766   17767   17768   17769   17770   17771   17772   17773   17774   17775   17776   17777   17778   17779   17780   17781   17782   17783   17784   17785   17786   17787   17788   17789   17790   17791   17792   17793   17794   17795   17796   17797   17798   17799   17800   17801   17802   17803   17804   17805   17806   17807   17808   17809   17810   17811   17812   17813   17814   17815   17816   17817   17818   17819   17820   17821   17822   17823   17824   17825   17826   17827   17828   17829   17830   17831   17832   17833   17834   17835   17836   17837   17838   17839   17840   17841   17842   17843   17844   17845   17846   17847   17848   17849   17850   17851   17852   17853   17854   17855   17856   17857   17858   17859   17860   17861   17862   17863   17864   17865   17866   17867   17868   17869   17870   17871   17872   17873   17874   17875   17876   17877   17878   17879   17880   17881   17882   17883   17884   17885   17886   17887   17888   17889   17890   17891   17892   17893   17894   17895   17896   17897   17898   17899   17900   17901   17902   17903   17904   17905   17906   17907   17908   17909   17910   17911   17912   17913   17914   17915   17916   17917   17918   17919   17920   17921   17922   17923   17924   17925   17926   17927   17928   17929   17930   17931   17932   17933   17934   17935   17936   17937   17938   17939   17940   17941   17942   17943   17944   17945   17946   17947   17948   17949   17950   17951   17952   17953   17954   17955   17956   17957   17958   17959   17960   17961   17962   17963   17964   17965   17966   17967   17968   17969   17970   17971   17972   17973   17974   17975   17976   17977   17978   17979   17980   17981   17982   17983   17984   17985   17986   17987   17988   17989   17990   17991   17992   17993   17994   17995   17996   17997   17998   17999   18000   18001   18002   18003   18004   18005   18006   18007   18008   18009   18010   18011   18012   18013   18014   18015   18016   18017   18018   18019   18020   18021   18022   18023   18024   18025   18026   18027   18028   18029   18030   18031   18032   18033   18034   18035   18036   18037   18038   18039   18040   18041   18042   18043   18044   18045   18046   18047   18048   18049   18050   18051   18052   18053   18054   18055   18056   18057   18058   18059   18060   18061   18062   18063   18064   18065   18066   18067   18068   18069   18070   18071   18072   18073   18074   18075   18076   18077   18078   18079   18080   18081   18082   18083   18084   18085   18086   18087   18088   18089   18090   18091   18092   18093   18094   18095   18096   18097   18098   18099   18100   18101   18102   18103   18104   18105   18106   18107   18108   18109   18110   18111   18112   18113   18114   18115   18116   18117   18118   18119   18120   18121   18122   18123   18124   18125   18126   18127   18128   18129   18130   18131   18132   18133   18134   18135   18136   18137   18138   18139   18140   18141   18142   18143   18144   18145   18146   18147   18148   18149   18150   18151   18152   18153   18154   18155   18156   18157   18158   18159   18160   18161   18162   18163   18164   18165   18166   18167   18168   18169   18170   18171   18172   18173   18174   18175   18176   18177   18178   18179   18180   18181   18182   18183   18184   18185   18186   18187   18188   18189   18190   18191   18192   18193   18194   18195   18196   18197   18198   18199   18200   18201   18202   18203   18204   18205   18206   18207   18208   18209   18210   18211   18212   18213   18214   18215   18216   18217   18218   18219   18220   18221   18222   18223   18224   18225   18226   18227   18228   18229   18230   18231   18232   18233   18234   18235   18236   18237   18238   18239   18240   18241   18242   18243   18244   18245   18246   18247   18248   18249   18250   18251   18252   18253   18254   18255   18256   18257   18258   18259   18260   18261   18262   18263   18264   18265   18266   18267   18268   18269   18270   18271   18272   18273   18274   18275   18276   18277   18278   18279   18280   18281   18282   18283   18284   18285   18286   18287   18288   18289   18290   18291   18292   18293   18294   18295   18296   18297   18298   18299   18300   18301   18302   18303   18304   18305   18306   18307   18308   18309   18310   18311   18312   18313   18314   18315   18316   18317   18318   18319   18320   18321   18322   18323   18324   18325   18326   18327   18328   18329   18330   18331   18332   18333   18334   18335   18336   18337   18338   18339   18340   18341   18342   18343   18344   18345   18346   18347   18348   18349   18350   18351   18352   18353   18354   18355   18356   18357   18358   18359   18360   18361   18362   18363   18364   18365   18366   18367   18368   18369   18370   18371   18372   18373   18374   18375   18376   18377   18378   18379   18380   18381   18382   18383   18384   18385   18386   18387   18388   18389   18390   18391   18392   18393   18394   18395   18396   18397   18398   18399   18400   18401   18402   18403   18404   18405   18406   18407   18408   18409   18410   18411   18412   18413   18414   18415   18416   18417   18418   18419   18420   18421   18422   18423   18424   18425   18426   18427   18428   18429   18430   18431   18432   18433   18434   18435   18436   18437   18438   18439   18440   18441   18442   18443   18444   18445   18446   18447   18448   18449   18450   18451   18452   18453   18454   18455   18456   18457   18458   18459   18460   18461   18462   18463   18464   18465   18466   18467   18468   18469   18470   18471   18472   18473   18474   18475   18476   18477   18478   18479   18480   18481   18482   18483   18484   18485   18486   18487   18488   18489   18490   18491   18492   18493   18494   18495   18496   18497   18498   18499   18500   18501   18502   18503   18504   18505   18506   18507   18508   18509   18510   18511   18512   18513   18514   18515   18516   18517   18518   18519   18520   18521   18522   18523   18524   18525   18526   18527   18528   18529   18530   18531   18532   18533   18534   18535   18536   18537   18538   18539   18540   18541   18542   18543   18544   18545   18546   18547   18548   18549   18550   18551   18552   18553   18554   18555   18556   18557   18558   18559   18560   18561   18562   18563   18564   18565   18566   18567   18568   18569   18570   18571   18572   18573   18574   18575   18576   18577   18578   18579   18580   18581   18582   18583   18584   18585   18586   18587   18588   18589   18590   18591   18592   18593   18594   18595   18596   18597   18598   18599   18600   18601   18602   18603   18604   18605   18606   18607   18608   18609   18610   18611   18612   18613   18614   18615   18616   18617   18618   18619   18620   18621   18622   18623   18624   18625   18626   18627   18628   18629   18630   18631   18632   18633   18634   18635   18636   18637   18638   18639   18640   18641   18642   18643   18644   18645   18646   18647   18648   18649   18650   18651   18652   18653   18654   18655   18656   18657   18658   18659   18660   18661   18662   18663   18664   18665   18666   18667   18668   18669   18670   18671   18672   18673   18674   18675   18676   18677   18678   18679   18680   18681   18682   18683   18684   18685   18686   18687   18688   18689   18690   18691   18692   18693   18694   18695   18696   18697   18698   18699   18700   18701   18702   18703   18704   18705   18706   18707   18708   18709   18710   18711   18712   18713   18714   18715   18716   18717   18718   18719   18720   18721   18722   18723   18724   18725   18726   18727   18728   18729   18730   18731   18732   18733   18734   18735   18736   18737   18738   18739   18740   18741   18742   18743   18744   18745   18746   18747   18748   18749   18750   18751   18752   18753   18754   18755   18756   18757   18758   18759   18760   18761   18762   18763   18764   18765   18766   18767   18768   18769   18770   18771   18772   18773   18774   18775   18776   18777   18778   18779   18780   18781   18782   18783   18784   18785   18786   18787   18788   18789   18790   18791   18792   18793   18794   18795   18796   18797   18798   18799   18800   18801   18802   18803   18804   18805   18806   18807   18808   18809   18810   18811   18812   18813   18814   18815   18816   18817   18818   18819   18820   18821   18822   18823   18824   18825   18826   18827   18828   18829   18830   18831   18832   18833   18834   18835   18836   18837   18838   18839   18840   18841   18842   18843   18844   18845   18846   18847   18848   18849   18850   18851   18852   18853   18854   18855   18856   18857   18858   18859   18860   18861   18862   18863   18864   18865   18866   18867   18868   18869   18870   18871   18872   18873   18874   18875   18876   18877   18878   18879   18880   18881   18882   18883   18884   18885   18886   18887   18888   18889   18890   18891   18892   18893   18894   18895   18896   18897   18898   18899   18900   18901   18902   18903   18904   18905   18906   18907   18908   18909   18910   18911   18912   18913   18914   18915   18916   18917   18918   18919   18920   18921   18922   18923   18924   18925   18926   18927   18928   18929   18930   18931   18932   18933   18934   18935   18936   18937   18938   18939   18940   18941   18942   18943   18944   18945   18946   18947   18948   18949   18950   18951   18952   18953   18954   18955   18956   18957   18958   18959   18960   18961   18962   18963   18964   18965   18966   18967   18968   18969   18970   18971   18972   18973   18974   18975   18976   18977   18978   18979   18980   18981   18982   18983   18984   18985   18986   18987   18988   18989   18990   18991   18992   18993   18994   18995   18996   18997   18998   18999   19000   19001   19002   19003   19004   19005   19006   19007   19008   19009   19010   19011   19012   19013   19014   19015   19016   19017   19018   19019   19020   19021   19022   19023   19024   19025   19026   19027   19028   19029   19030   19031   19032   19033   19034   19035   19036   19037   19038   19039   19040   19041   19042   19043   19044   19045   19046   19047   19048   19049   19050   19051   19052   19053   19054   19055   19056   19057   19058   19059   19060   19061   19062   19063   19064   19065   19066   19067   19068   19069   19070   19071   19072   19073   19074   19075   19076   19077   19078   19079   19080   19081   19082   19083   19084   19085   19086   19087   19088   19089   19090   19091   19092   19093   19094   19095   19096   19097   19098   19099   19100   19101   19102   19103   19104   19105   19106   19107   19108   19109   19110   19111   19112   19113   19114   19115   19116   19117   19118   19119   19120   19121   19122   19123   19124   19125   19126   19127   19128   19129   19130   19131   19132   19133   19134   19135   19136   19137   19138   19139   19140   19141   19142   19143   19144   19145   19146   19147   19148   19149   19150   19151   19152   19153   19154   19155   19156   19157   19158   19159   19160   19161   19162   19163   19164   19165   19166   19167   19168   19169   19170   19171   19172   19173   19174   19175   19176   19177   19178   19179   19180   19181   19182   19183   19184   19185   19186   19187   19188   19189   19190   19191   19192   19193   19194   19195   19196   19197   19198   19199   19200   19201   19202   19203   19204   19205   19206   19207   19208   19209   19210   19211   19212   19213   19214   19215   19216   19217   19218   19219   19220   19221   19222   19223   19224   19225   19226   19227   19228   19229   19230   19231   19232   19233   19234   19235   19236   19237   19238   19239   19240   19241   19242   19243   19244   19245   19246   19247   19248   19249   19250   19251   19252   19253   19254   19255   19256   19257   19258   19259   19260   19261   19262   19263   19264   19265   19266   19267   19268   19269   19270   19271   19272   19273   19274   19275   19276   19277   19278   19279   19280   19281   19282   19283   19284   19285   19286   19287   19288   19289   19290   19291   19292   19293   19294   19295   19296   19297   19298   19299   19300   19301   19302   19303   19304   19305   19306   19307   19308   19309   19310   19311   19312   19313   19314   19315   19316   19317   19318   19319   19320   19321   19322   19323   19324   19325   19326   19327   19328   19329   19330   19331   19332   19333   19334   19335   19336   19337   19338   19339   19340   19341   19342   19343   19344   19345   19346   19347   19348   19349   19350   19351   19352   19353   19354   19355   19356   19357   19358   19359   19360   19361   19362   19363   19364   19365   19366   19367   19368   19369   19370   19371   19372   19373   19374   19375   19376   19377   19378   19379   19380   19381   19382   19383   19384   19385   19386   19387   19388   19389   19390   19391   19392   19393   19394   19395   19396   19397   19398   19399   19400   19401   19402   19403   19404   19405   19406   19407   19408   19409   19410   19411   19412   19413   19414   19415   19416   19417   19418   19419   19420   19421   19422   19423   19424   19425   19426   19427   19428   19429   19430   19431   19432   19433   19434   19435   19436   19437   19438   19439   19440   19441   19442   19443   19444   19445   19446   19447   19448   19449   19450   19451   19452   19453   19454   19455   19456   19457   19458   19459   19460   19461   19462   19463   19464   19465   19466   19467   19468   19469   19470   19471   19472   19473   19474   19475   19476   19477   19478   19479   19480   19481   19482   19483   19484   19485   19486   19487   19488   19489   19490   19491   19492   19493   19494   19495   19496   19497   19498   19499   19500   19501   19502   19503   19504   19505   19506   19507   19508   19509   19510   19511   19512   19513   19514   19515   19516   19517   19518   19519   19520   19521   19522   19523   19524   19525   19526   19527   19528   19529   19530   19531   19532   19533   19534   19535   19536   19537   19538   19539   19540   19541   19542   19543   19544   19545   19546   19547   19548   19549   19550   19551   19552   19553   19554   19555   19556   19557   19558   19559   19560   19561   19562   19563   19564   19565   19566   19567   19568   19569   19570   19571   19572   19573   19574   19575   19576   19577   19578   19579   19580   19581   19582   19583   19584   19585   19586   19587   19588   19589   19590   19591   19592   19593   19594   19595   19596   19597   19598   19599   19600   19601   19602   19603   19604   19605   19606   19607   19608   19609   19610   19611   19612   19613   19614   19615   19616   19617   19618   19619   19620   19621   19622   19623   19624   19625   19626   19627   19628   19629   19630   19631   19632   19633   19634   19635   19636   19637   19638   19639   19640   19641   19642   19643   19644   19645   19646   19647   19648   19649   19650   19651   19652   19653   19654   19655   19656   19657   19658   19659   19660